Amore.se Favicon Amore.se

Amore.se Website Thumbnail
Checking...
Amore — Secure
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
amore
Domain extension
se
Domain registered:
2019-07-15
Domain updated:
2020-09-09
Domain expires:
2021-07-15
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is amore.se ranked relative to other sites:

Percentage of visits to amore.se from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Amore.se registered?
A: Amore.se was registered 1 year, 2 months, 1 week, 3 days, 23 hours, 44 minutes, 44 seconds ago on Monday, July 15, 2019.
Q: When was the WHOIS for Amore.se last updated?
A: The WHOIS entry was last updated 2 weeks, 2 days, 23 hours, 44 minutes, 44 seconds ago on Wednesday, September 9, 2020.
Q: What are Amore.se's nameservers?
A: DNS for Amore.se is provided by the following nameservers:
  • ns1.loopia.se
  • ns2.loopia.se
Q: Who is the registrar for the Amore.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Amore.se?
A: Amore.se has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Amore.se each day?
A: Amore.se receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Amore.se resolve to?
A: Amore.se resolves to the IPv4 address 198.185.159.145.
Q: In what country are Amore.se servers located in?
A: Amore.se has servers located in the United States.
Q: What webserver software does Amore.se use?
A: Amore.se is powered by Squarespace webserver.
Q: Who hosts Amore.se?
A: Amore.se is hosted by Squarespace, Inc. in New York, New York, United States, 10013.
Q: How much is Amore.se worth?
A: Amore.se has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Amore.se?

Amore.se Hosting Provider Information

Hosted IP Address:198.185.159.145
Hosted Hostname:198.185.159.145
Service Provider:Squarespace, Inc.
Hosted Country:United StatesUS
Location Latitude:40.7157
Location Longitude:-74
Webserver Software:Squarespace

Is "Squarespace, Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Amore.se

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
date: Wed, 09 Sep 2020 11:40:33 GMT
location: https://www.amore.se/
Age: 3719
Content-Length: 0
x-contextid: 1h5K6Avm/PpaWOo3g
server: Squarespace

Amore.se Domain Nameserver Information

HostIP AddressCountry
ns1.loopia.se 93.188.0.20
ns2.loopia.se 93.188.0.21


Need to find out who hosts Amore.se?


WhoIs information for Amore.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: amore.se
holder: lvw0832-2707607
admin-c: -
tech-c: -
billing-c: -
created: 2019-07-15
modified: 2020-04-25
expires: 2020-07-15
transferred: 2020-02-14
nserver: ns1.loopia.se
nserver: ns2.loopia.se
dnssec: signed delegation
registry-lock: unlocked
status: ok
registrar: Loopia AB

Amore.se Free SEO Report

Website Inpage Analysis for Amore.se

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Amore.se

dataslicetypesocialicons tumblreaseinotransitionopacity 2s170ms easeoutopacity 170msbehancesocialiconssizemediumsocialiconsstyleknockoutuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsfivehundredpixhover170ms easeinout bordercolorstitcherdataslicetypesocialiconshover spotifydataslicetypesocialiconshover tidalhoverdataslicetypesocialiconshover vimeohoversqsslicecustomform asqsslidewrapperdataslidetypelockscreengmnoprintresponsivewrapperstackedthedotshoverdataslicetypesocialiconshover instagramhovericonwrapperwidth32pxheight32pxmargin0videoiconstyleborderdataslicetypealbum iconwrappersqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleftsocialstackedsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons lieaseinoutmoztransitionbackgroundcoloruseiconfill00ab6csqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover linkedinli0 0sqsslidewrapperdataslidetypelockscreensqsmodallightboxcontentdataslicetypesocialicons rdiodataslicetypebuttons ahoversqsslidewrapperdataslidetypelockscreendataslicetypesocialicons emailbuttonstylesolidvinesqsslidewrapperdataslidetypelockscreen dataslicetypecountdown countdowncontentdataformatnumericiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstyleknockoutdataslicetypebuttons lilockstyleknockoutdataslicetypenavigationimdbsocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypealbum iconwrappersqsslidewrapperdataslidetypelockscreenuseiconfille6b91esqsslidewrapperdataslidetypelockscreenpasswordstylerectangle dataslicetypepassworddropboxinputwrapperdataslicetypesocialicons googledataslicetypesocialicons codepenemailpasswordstyleunderlined dataslicetypepasswordsocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsdataslicetypenavigation ul liinstagramsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonsdatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypelockscreenuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstyleknockoutsqsslidesqsslideanimationreadymediumhoversocialiconscolorstandardsocialiconsstyleborderdataslicetypesocialicons mediumdataslicetypesocialiconshover twitchsqsslidewrapperdataslidetypelockscreen dataslicetypecountdowndataslicetypecountdown countdowncontentdataformatnumericiconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypelockscreenuseiconfillae995asqsslidewrapperdataslidetypelockscreenusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverneuearialsansseriffontsize14pxlineheight13emtexttransformnoneletterspacing05emfontweightnormalfontstylenormalcolor3a3a3asqsslidewrapperdataslidetypelockscreenvideoiconstylesolidsocialiconssizelargesocialiconsstyleborderuseiconfillff0031sqsslidewrapperdataslidetypelockscreenbuttonstyleoutlinesqsmodallightbox formwrappertrackprogressbar170ms easeinoutmstransitionbackgroundcolorsocialiconssizemediumsocialiconsstyleregulardataslicetypesocialiconshover applepodcast7pxscreen and maxwidth600pxsqsslidewrapperdataslidetypelockscreensocialiconssizesmallsocialiconsstyleborderdataslicetypesocialiconshover codepenhoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregularuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregularbuttonstyleoutline dataslicetypebuttonsshowtracktitleeaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolordataslicetypesocialicons houzzsqsslicecustomform spansqsslidewrapperdataslidetypelockscreenvideoiconstyleknockoutactionsstacked inputwrapperdataslicetypesocialiconshover dribbblesqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcenterulsqsslidewrapperdataslidetypelockscreeniconwrapperwidth28pxheight28pxmargin0sqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineflickr0ms 0mssqsslicealbumplayliststacked170ms easeinoutmoztransitionbackgroundcolor 170msuseiconfillec4652sqsslidewrapperdataslidetypelockscreensocialiconssizeextrasmallsocialiconsstyleborderdataslicetypesocialiconshover meetupimportantsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesqsslidelayercontentsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonssmugmugdataslicetypesocialiconshover iconwrapperhovermapstyleminimaldarklinkedindataslicetypegallerysqsgallerygriddataslicetypesocialicons youtubeituneshoveruseiconfillfffsqsslidewrapperdataslidetypelockscreentidalhoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayaction170ms easeoutopacitybuttonshapepilldataslicetypesocialiconsuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleborder170ms easeinoutmoztransitionbackgroundcolordataslicetypealbumhover iconwrapperuseiconfille0393esqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconssocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverdataslicetypesocialiconshover emaildataslicetypemap gmstyleccstumbleuponhoverdataslicetypesocialicons stumbleupondataslicetypebuttons lisqsslidewrapperdataslidetypelockscreendataslicetypebody psvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypelockscreensqsslicealbumplaylistdataslicetypesocialicons smugmugactionsnotstacked inputwrappernothiddenapplepodcasteaseinoutdisclaimercontainersqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover googleplaytwitchonly screeneaseoutopacitydataslicetypesocialicons twitchfacebookeaseinmstransitionopacity 2sdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstylesolidiconwrapperhoverasqsslidewrapperdataslidetypelockscreen dataslicetypetwitterdataslicetypesocialiconshover iconwrapperdataslicetypemapusebackgroundfillfffsqsslidewrapperdataslidetypelockscreendataslicetypeheadingnotdatacompoundtypesvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcolorsocialiconsstylesolid dataslicetypesocialiconshoveruseiconfille4405fsqsslidewrapperdataslidetypelockscreenuseiconfillcc2127sqsslidewrapperdataslidetypelockscreenlockstyleregularsocialiconsstylesolid dataslicetypesocialiconshover iconwrapperformwrapper inputtypesubmithoversqsslidewrapperdataslidetypelockscreensqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover yelpsocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypegallery galleryvideobackgroundmobileuseiconfill007ee5sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover stumbleuponhovereaseinoutotransitionbackgroundcolordataslicetypesocialiconshover yelphoverdataslicetypesocialiconshover googleplayhoverdataslicetypetwitternotdatacompoundtype tweetbodydataslicetypesocialiconshover soundcloudhover0sqsslidewrapperdataslidetypelockscreen1pxaudioplayericonsstylesolid dataslicetypealbumhoverautosqsslidewrapperdataslidetypelockscreenmediumsqsmodallightboxopeniconwrapperlisqsslidewrapperdataslidetypelockscreenflickrhoversquarespacehoveruldataslicetypebuttons ul lisqsslidewrapperdataslidetypelockscreenbuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreensnapchathovereaseinouttransitioncoloreaseintransitionopacitycountdowncontentdataformattextualsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody pusebackgroundfilltransparentsqsslidewrapperdataslidetypelockscreenmeetuphoverusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreendataslicetypebodydataslicetypesocialiconshover twitchhovericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked5pxsqsalbumminimal dataslicetypealbumdataslicetypesocialiconshover vinesocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreenadisplayblocksqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover itunesdatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypelockscreen2s easeinotransitionopacity 2s2s easeinmoztransitionopacitycountdownuniteaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypelockscreenformwrapperdataslicetypesocialiconshover mediumhoversocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverp170ms easeinoutsqsslidewrapperdataslidetypelockscreenuseiconfillff4500sqsslidewrapperdataslidetypelockscreenimportantsqsslidewrapperdataslidetypelockscreen sqsslidecontainernotautoimagebackgroundcolorsqsalbumminimalli ahoversqsslidewrapperdataslidetypelockscreensvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverlightboxinner lightboxcontenteaseinmoztransitionopacitygooglehoverli asqsslidewrapperdataslidetypelockscreenuseiconfill6441a5sqsslidewrapperdataslidetypelockscreeneaseinoutsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons vimeodribbbleuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsbordercolorshowtracktitle sqsalbumminimaldataslicetypesocialiconshover tidalsocialiconsstylesolidactionsnotstackedfacebookhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreenbuttonstyleraisedsqsslidewrapperdataslidetypelockscreen dataslicetypebuttonsvinehoverdataslicetypetwitternotdatacompoundtype tweettimestampdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstylesoliddataslicetypecountdownrdiousemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutdataslicetypesocialiconshover reddithoverul lisqsslidewrapperdataslidetypelockscreensocialiconssizeextrasmallsocialiconsstyleregulardataslicetypesocialiconshover emailhoverdataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypelockscreenasqsslidewrapperdataslidetypelockscreen buttonstyleoutlinebuttonsqsslidewrapperdataslidetypelockscreendataslicetypebuttons asqsslidewrapperdataslidetypelockscreeneaseinoutsqsslidewrapperdataslidetypelockscreen socialiconsstylesolidvscouseiconfill7dbb00sqsslidewrapperdataslidetypelockscreencodependataslicetypesocialicons vscoactionssqsslidewrapperdataslidetypelockscreensocialiconssizemediumsocialiconsstylesolidsocialiconssizesmallsocialiconsstylesolidsqsslicealbumplaylist tracks tracktweetbodygithub2s 2sresponsivewrapperstacked dataslicetypebuttons5emfont14pxeaseintransitionopacity 2siconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstyleknockoutp asqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover thedots170ms easeinoutsqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbum4pxtidaliconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstylesoliduseiconfill1769ffsqsslidewrapperdataslidetypelockscreeninputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutlineinputwrappernothiddenbuttonsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackeddataslicetypesocialiconshover googlehoverdataslicetypesocialiconshover smugmugeaseinoutmstransitioncolorfoursquarelinkedinhoveruseiconfillf60sqsslidewrapperdataslidetypelockscreendataslicetypealbumhover iconwrapperhoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrapperbuttonstyleoutlineformwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreenthedotsp ahoversqsslidewrapperdataslidetypelockscreenaudioplayericonsstyleborder dataslicetypealbumdataslicetypesocialiconshover squarespacehoverreddithovericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstyleknockoutuseiconfill1ab7easqsslidewrapperdataslidetypelockscreenbuttonstyleoutline sqsslicecustomformdataslicetypesocialiconshover fivehundredpixhoverinputtypetextsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypealbum trackprogressbar2s easeinmoztransitionopacity 2ssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonsdataslicetypesocialiconshover facebookhover170ms easeinoutmstransitionbackgroundcolor 170msdataslicetypecountdown countdowncontentdataformattextual2s easeinotransitionopacityactionsstackedyelpdataslicetypebuttonsresponsivewrappernotstackeduseiconfillf94877sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinerdiohoveraudioplayericonsstyleborderyoutubedataslicetypesocialicons squarespacedataslicetypesocialiconshover houzzdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstyleknockoutscreensqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlineduseiconfill0063dcsqsslidewrapperdataslidetypelockscreenuseiconfilldc4e41sqsslidewrapperdataslidetypelockscreen1lightboxinnergithubhoverdataslicetypesocialiconshover ituneshoverresponsivewrapperstacked dataslicetypenavigation2s easeinmstransitionopacity 2sdataslicetypesocialiconshover codepenformitemsqsslidewrapperdataslidetypelockscreendataslicetypegalleryinstagramhover2seaseinout bordercolor 170mssnapchatsqsslicealbumplaylistplayinginputtypesubmitsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons bandsintowntwitchhoversocialiconssizesmallsocialiconsstyleregularsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautoonlyuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutsocialiconsstyleknockout dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddenuseiconfilltransparentsqsslidewrapperdataslidetypelockscreenbuttonplaypauseusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypebuttonssqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlay captchacontainerwrapperdataslicetypepassworddataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypelockscreendataslicetypealbum sqsslicealbumplaylistplayingeaseinouttransitionbackgroundcolorsqsmodallightboxcontent lightboxinnerpinterestdataslicetypesocialiconshover squarespacedataslicetypesocialicons twitterdataslicetypesocialiconshover thedotshoveruseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregulardataslicetypesocialiconshover bandsintownhovereaseinmoztransitionopacity 2sdataslicetypesocialiconshover goodreadsfffsqsslidewrapperdataslidetypelockscreensocialstackedtextalignleft10pxsqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangledataslicetypesocialiconshover behanceautoflex1socialiconsstyleborder dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackedall and maxwidth600pxsqsslidewrapperdataslidetypelockscreen0ms2em 0px 0pxsocialiconsstyleregular dataslicetypesocialiconssocialiconsstyleknockoutdataslicetypesocialicons itunesdatacompoundtypepopupoverlayactionul libordercolor 170msdataslicetypesocialicons applepodcastsqsslicecustomformsocialiconssizesmallsocialiconsstyleknockoutbuttonstyleoutlinesqsmodallightboxdataslicetypesocialicons thedotslightboxcontent formwrappersvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesoliddropboxhover170ms easeinouttransitionbackgroundcoloraudioplayericonsstyleknockoutdataslicetypesocialiconshover twitterhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstyleknockouteaseinmstransitionopacitydataslicetypesocialiconshover pinteresthoverul li asqsslidewrapperdataslidetypelockscreenusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidsqssliceplaybuttoniconwrapperdataslicetypemap gmnoprintdataslicetypesocialiconshover vinehovereaseinout bordercolordataslicetypesocialicons redditdataslicetypesocialicons googleplaylockstylesolidsocialiconssizeextralargesocialiconsstyleregulardataslicetypesocialiconshover rdiohoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconseaseinoutmstransitionbackgroundcolor 170msdataslicetypesocialiconshover rsshoveruseiconfillc41200sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vevohoverdataslicetypetwitter tweetavatardataslicetypesocialiconshover behancehoverallsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrapperpasswordstyleunderlinedeaseinoutmstransitionbackgroundcolorarrowicon2s easeintransitionopacity 2sdataslicetypesocialiconshover vscohoversqsslidewrapperdataslidetypelockscreen responsivewrappernotstackedpasswordstylerectangle1slockstylesolid dataslicetypelock2s easesqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautosqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlinedataslicetypesocialicons dribbblesoundcloudhoverinputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypegallery galleryvideobackgroundtwitterhoverdataslicetypesocialiconshover tumblrsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenableddataslicetypepassword arrowiconiconwrapperwidth24pxheight24pxmargin0asqsslidewrapperdataslidetypelockscreen buttonstyleoutline sqsslicecustomformlockstyleregular dataslicetypelockdataslicetypesocialiconshover rsssocialiconssizemediumsocialiconsstyleborderdataslicetypesocialicons stitcherdataslicetypesocialiconshover bandsintowndataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstyleknockoutgalleryvideobackgroundmobiledataslicetypesocialicons imdbdataslicetypesocialiconshover dropboxhoverdataslicetypesocialiconshover stitchereaseinotransitionopacityuseiconfill8c8070sqsslidewrapperdataslidetypelockscreen6pxasqsslidewrapperdataslidetypelockscreenuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialiconshover houzzhoverdataslicetypesocialiconshover pinterestdataslicetypesocialiconshover vscodataslicetypetwitter14pxtwitterdatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypelockscreengoodreadsdataslicetypesocialiconshover facebook8pxdisplaytablesqsslidewrapperdataslidetypelockscreensocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoveruseiconfill0976b4sqsslidewrapperdataslidetypelockscreendataslicetypebuttons li ahoversqsslidewrapperdataslidetypelockscreencaptchacontainerwrappericonwrapperlastchildmarginright0sqsslidewrapperdataslidetypelockscreensocialiconssizeextralargesocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddendataslicetypesocialiconshover stumbleupongoogleplaystumbleuponredditbuttonshaperoundedcornerssqsslidewrapperdataslidetypelockscreensmugmughovericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstylesolidbandsintowneaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcoloreaseoutopacity 170msdataslicetypesocialiconshover smugmughoverusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutaudioplayericonsstyleregulardataslicetypesocialiconshover rdioresponsivewrapperstacked dataslicetypebuttons uldataslicetypesocialiconshover flickrhoveraudioplayericonsstyleregular dataslicetypealbumuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover youtubehoversquarespaceuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoversqsslicecustomform ahoversqsslidewrapperdataslidetypelockscreenlockstylebordericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstylesoliddataslicetypealbum sqsslicealbumplaylistbuttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialicons flickrsqsslicealbumplaylistdemoalbum100mssqsmodallightboxcontent lightboxinner lightboxcontentdataslicetypesocialiconshover foursquare2em 0px170ms easeinoutotransitionbackgroundcolor 170msuseiconfill000sqsslidewrapperdataslidetypelockscreen0avisitedsqsslidewrapperdataslidetypelockscreensvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovertrackssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonsfoursquarehoverdataslicetypesocialicons goodreadseaseinoutotransitioncolordataslicetypesocialiconshover vimeousemaskfill222sqsslidewrapperdataslidetypelockscreensqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover goodreadshoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstylesolidinputtypetextsqsslidewrapperdataslidetypelockscreeneaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcolordataslicetypesocialiconshover dribbblehoveruseiconfill4183c4sqsslidewrapperdataslidetypelockscreeniconwrapperwidth36pxheight36pxmargin0socialiconssizeextrasmallsocialiconsstylesoliddataslicetypebuttons ulusemaskfilltransparentsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutlinesocialiconssizeextralargesocialiconsstylesolidlockstyleknockout dataslicetypelockuseiconfill3b5998sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactionsocialiconsstyleborderrssinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypelockscreendataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaysocialiconsstyleregularuseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovercountdowncontentdataformattextual countdownunit3pxsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodysvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreenlockstyleborder dataslicetypelockeaseinoutmoztransitioncolordataslicetypesocialicons facebookmeetupsocialiconssizelargesocialiconsstylesoliduseiconfill382110sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover linkedinhovertracktitletracks trackdataslicetypesocialicons dropboxtumblrdataslicetypesocialicons soundcloudlightboxcontent formwrapper pvevodataslicetypesocialiconshover githubhoverdataslicetypesocialiconshover applepodcasthoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactionhouzzhoverdataslicetypesocialiconshover githubresponsivewrapperstacked sqsslicecustomformvscohoversocialiconscolorstandardsocialiconsstyleregularpinteresthovericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstylesolidsqsslidecontainernotautoimagebackgroundcolorimdbhoversvgsocialwebkittransitionbackgroundcolor 170msbordercolor 170ms easeinoutsqsslidewrapperdataslidetypelockscreendataslicetypealbum sqsslicealbumplaylist trackstracksvgsocialwebkittransitionbackgroundcolordataslicetypesocialicons pinterestdataslicetypesocialicons githubdataslicetypesocialicons vevoeaseinoutmoztransitionbackgroundcolor 170msdataslicetypesocialiconshover soundclouduseiconfill1ea9e1sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstylesoliddataslicetypesocialiconshover stitcherhoversocialiconscolorstandardsocialiconsstyleknockouttweetdisplayname01s0pxdataslicetypesocialicons fivehundredpixsocialiconssizeextrasmallsocialiconsstyleknockoutsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidgmstylecc2s easeinmstransitionopacitysocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreenuseiconfill006ed2sqsslidewrapperdataslidetypelockscreensocialiconsstylesolid dataslicetypesocialiconsdataslicetypesocialiconshovericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstyleknockoutspotifyhoverdataslicetypesocialiconshover mediumsqssliceplaybuttoniconwrapperhoverdataslicetypesocialiconshover snapchathoverlightboxcontentaudioplayericonsstylesolidbehancehoveruseiconfilleb4924sqsslidewrapperdataslidetypelockscreenuseiconfill7ac143sqsslidewrapperdataslidetypelockscreenvimeohovergoogleplayhoveruseiconfill222sqsslidewrapperdataslidetypelockscreenhouzzeaseinoutotransitionbackgroundcolor 170msbuttontypesubmitsqsslidewrapperdataslidetypelockscreendataslicetypetwitternotdatacompoundtypeapplepodcasthover170msimportantsqsslidewrapperdataslidetypelockscreenuseiconfill0099e5sqsslidewrapperdataslidetypelockscreeneaseinouttransitionbackgroundcolor 170msuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverdataslicetypecountdown countdowncontentdataformattextual countdownunitdataslicetypesocialiconshover meetuphoverdataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover spotifyhoverlightboxinner lightboxcontent formwrapperuseiconfill55aceesqsslidewrapperdataslidetypelockscreendataslicetypealbumhoverdataslicetypebuttons ulsqsslidewrapperdataslidetypelockscreensocialiconssizelargesocialiconsstyleknockouticonwrapperlastchildsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons linkedinsqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentbordersocialiconssizelargesocialiconsstyleregulardataslicetypesocialicons instagramdataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypelockscreensqsmodallightboxbandsintownhoversqsslicecustomformsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover snapchatfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emdataslicetypesocialicons yelpuseiconfille52d27sqsslidewrapperdataslidetypelockscreenuseiconfill00b488sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons meetupactionsstacked inputwrappernothiddentweethandlemaxwidth600pxsqsslidewrapperdataslidetypelockscreendataslicetypelock2emdataslicetypenavigation ulspansqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vevodataslicetypesocialiconshover flickrdataslicetypesocialiconshover imdbdatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover foursquarehovercodepenhoverdataslicetypesocialicons rssinputtypepasswordsqsslidewrapperdataslidetypelockscreenahoversqsslidewrapperdataslidetypelockscreenvevohoversqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactionuseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreensqsslicealbumplaylist trackssqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackedneuearialsansseriffontweightnormalfontstylenormalletterspacing6pxsqsslidewrapperdataslidetypelockscreenfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxresponsivewrapperstacked dataslicetypenavigation uldataslicetypesocialiconshover tumblrhoverdataslicetypebuttons ulstackedsocialiconssizeextralargesocialiconsstyleborderdataslicetypesocialiconshover dropboxuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovergalleryvideobackgrounddataslicetypesocialicons snapchattweettimestampsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactionshowtracktitle sqsalbumminimal dataslicetypealbumeasesqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraiseddataslicetypesocialiconshover redditgoogleyoutubehoverdataslicetypealbum sqsslicealbumplaylistdemoalbumuseiconfillea4c89sqsslidewrapperdataslidetypelockscreenvimeoemailhovericonwrappersqsslidewrapperdataslidetypelockscreendataslicetypesocialicons foursquare170ms easeinoutotransitionbackgroundcolordataslicetypealbum tracktitledataslicetypebuttons li asqsslidewrapperdataslidetypelockscreenuseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialiconshover instagramerrormessagesqsslidewrapperdataslidetypelockscreendataslicetypealbum sqsslicealbumplayliststackedsocialstackedtextalignleft dataslicetypesocialiconsformitemsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialicons spotifystitcherhoverbuttonsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineformwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutlineuseiconfill222backgroundcolor222sqsslidewrapperdataslidetypelockscreenulstackediconwrapperborder2pxrsshoveritunesdataslicetypealbuminputtypesubmithoversqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialicons tidaldataslicetypesocialiconshover twitter2s easeintransitionopacitytweetavatardataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypelockscreenspotifysocialiconscolorstandardsocialiconsstylesoliduseiconfill84bd00sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackeddataslicetypesocialiconshover fivehundredpixgoodreadshoversoundcloudsqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideindataslicetypesocialiconshover imdbhovertumblrhoversolidyelphoverfivehundredpixsqsalbumminimal dataslicetypealbum sqsslicealbumplaylistsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactionsqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlinedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstyleknockoutdataslicetypebuttons ul liiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstylesoliduseiconfill35465dsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover youtubeuseiconfill5adfcbsqsslidewrapperdataslidetypelockscreen170ms easeinouttransitionbackgroundcolor 170msresponsivewrapperstackedtextaligncenterdataslicetypesocialicons vineformwrapper presponsivewrapper0px 0pxdataslicetypesocialicons behancevideoiconstyleregulardribbblehovercountdowncontentdataformatnumericsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreenuseiconfill00b4b3sqsslidewrapperdataslidetypelockscreensocialstacked dataslicetypesocialiconsdataslicetypesocialiconshover google

Longtail Keyword Density for Amore.se

KeywordsOccurences
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
ease-in-out border-color 170ms15
170ms ease-in-out border-color15
lightbox-inner lightbox-content form-wrapper14
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
170ms ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-outtransitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
show-track-title sqs-album-minimal data-slice-typealbum6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
2em 0px 0px6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typelock-screen5
data-slice-typenavigation ul li5
170ms ease-outopacity 170ms5
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typelock-screen4
data-slice-typebuttons ul li4
lightbox-content form-wrapper p4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
responsive-wrapperstacked data-slice-typenavigation ul4
responsive-wrapperstacked data-slice-typebuttons ul3
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
buttonsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typelock-screen3
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline data-compound-typepopup-overlay-action3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-solid3
screen and max-width600pxsqs-slide-wrapperdata-slide-typelock-screen3
ul li asqs-slide-wrapperdata-slide-typelock-screen3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
asqs-slide-wrapperdata-slide-typelock-screen button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-knockout3
all and max-width600pxsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid88
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid44
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstackedtext-align-left data-slice-typesocial-icons20
socialstacked data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
data-slice-typealbum sqs-slice-album-playlist15
170ms ease-in-out15
ease-in-out border-color15
border-color 170ms15
lightbox-content form-wrapper14
data-slice-typegallery gallery-video-background14
170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen13
data-slice-typebuttons ul12
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-border12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
data-slice-typealbum icon-wrapper11
sqs-slice-album-playlist tracks11
data-slice-typecountdown countdown-contentdata-formattextual11
0 0sqs-slide-wrapperdata-slide-typelock-screen11
data-slice-typebuttons li10
password-style-underlined data-slice-typepassword10
data-slice-typenavigation ul10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
ul li9
password-style-rectangle data-slice-typepassword9
social-icons-style-solid data-slice-typesocial-iconshover8
170ms ease-in-outtransitionbackground-color8
data-slice-typebody p8
ease-in-outtransitionbackground-color 170ms8
ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
ease-in-out-moz-transitionbackground-color 170ms8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typelock-screen8
li asqs-slide-wrapperdata-slide-typelock-screen8
170ms ease-in-out-moz-transitionbackground-color8
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typelock-screen7
social-icons-style-border data-slice-typesocial-icons7
show-track-title sqs-album-minimal7
tracks track7
button-style-outlinesqs-modal-lightbox form-wrapper7
button-style-outline data-compound-typepopup-overlay-action7
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen6
button-style-outline sqs-slice-custom-form6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typelock-screen6
data-slice-typesocial-iconshover icon-wrapperhover6
2em 0px6
data-slice-typealbum track-progress-bar6
audio-player-icons-style-border data-slice-typealbum6
0px 0px6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
button-style-outline data-slice-typebuttons6
ease-outopacity 170ms5
data-slice-typesocial-icons dropbox5
170ms ease-outopacity5
data-slice-typesocial-icons twitch5
ul lisqs-slide-wrapperdata-slide-typelock-screen5
responsive-wrapperstacked data-slice-typenavigation5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons dribbble5
asqs-slide-wrapperdata-slide-typelock-screen button-style-outline5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons codepen5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons github5
data-slice-typesocial-icons google5
responsive-wrapperstacked data-slice-typebuttons5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons flickr5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons email5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons vimeo5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons youtube5
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typebuttons5
data-slice-typesocial-iconshover icon-wrapper5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons vsco5
lock-style-regular data-slice-typelock5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons rdio5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
data-slice-typesocial-icons linkedin5
0ms 0ms5
data-slice-typesocial-icons applepodcast5
data-slice-typesocial-icons behance5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons vevo5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons bandsintown5
2s 2s5
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover rss4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover squarespace4
form-wrapper p4
data-slice-typesocial-iconshover yelp4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover vevohover4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover squarespacehover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover tidalhover4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover rdio4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover applepodcast4
audio-player-icons-style-solid data-slice-typealbumhover4
data-slice-typesocial-iconshover facebook4
data-slice-typealbumhover icon-wrapper4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typetwitternotdata-compound-type tweet-body4
lock-style-border data-slice-typelock4
actionsnotstacked input-wrappernothidden4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typelock-screen4
buttonsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
svgsocial-webkit-transitionbackground-color 170ms4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typelock-screen4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typelock-screen4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typelock-screen3
li ahoversqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typelock-screen3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen3
social-icons-style-knockout data-slice-typesocial-icons3
actionsstacked input-wrapper3
social-icons-style-solid data-slice-typesocial-icons3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typelock-screen3
inputtypetextsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
form-itemsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
importantsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typelock-screen3
lock-style-knockout data-slice-typelock3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
lock-style-solid data-slice-typelock3
sqs-slide-wrapperdata-slide-typelock-screen responsive-wrappernotstacked3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typelock-screen3
audio-player-icons-style-regular data-slice-typealbum3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typebuttons ulstacked3
data-slice-typemap gmnoprint3
data-slice-typemap gm-style-cc3
only screen3
data-slice-typealbum sqs-slice-album-playliststacked3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
data-slice-typealbum track-title3
data-slice-typegallery gallery-video-backgroundmobile3
data-slice-typetwitter tweet-avatar3
ease-intransitionopacity 2s3
2s ease-intransitionopacity3
ease-in-o-transitionopacity 2s3
2s ease-in-o-transitionopacity3
ease-in-ms-transitionopacity 2s3
2s ease-in-ms-transitionopacity3
ease-in-moz-transitionopacity 2s3
2s ease-in-moz-transitionopacity3
importantsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containernotauto-image-background-color3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
asqs-slide-wrapperdata-slide-typelock-screen data-slice-typetwitter3
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
countdown-contentdata-formattextual countdown-unit3
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typecountdown3
p ahoversqs-slide-wrapperdata-slide-typelock-screen3
p asqs-slide-wrapperdata-slide-typelock-screen3
ease-in-outsqs-slide-wrapperdata-slide-typelock-screen social-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-solid3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typelock-screen3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typepassword arrow-icon3
2s easesqs-slide-wrapperdata-slide-typelock-screen3
actionsstacked input-wrappernothidden3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen140
social-icons-color-standardsocial-icons-style-regular132
social-icons-color-standardsocial-icons-style-knockout132
data-slice-typealbum109
170ms90
data-compound-typepopup-overlay-action60
data-slice-typebuttons59
sqs-slide-containerdata-slide-typepopup-overlay51
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen44
2s41
asqs-slide-wrapperdata-slide-typelock-screen38
data-slice-typecountdown35
importantsqs-slide-wrapperdata-slide-typelock-screen34
data-slice-typegallery33
data-slice-typelock30
data-slice-typepassword29
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
form-wrapper28
sqs-album-minimal27
1s25
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen24
sqs-modal-lightbox-content24
sqs-slice-custom-form24
0sqs-slide-wrapperdata-slide-typelock-screen24
icon-wrapper23
lightbox-inner22
ul22
responsive-wrapperstacked21
socialstackedtext-align-left20
sqs-slide-wrapperdata-slide-typelock-screen20
socialstacked20
li20
020
lightbox-content19
button-style-outline19
countdown-contentdata-formatnumeric18
sqs-slice-album-playlist17
data-slice-typenavigation17
ease-in-outsqs-slide-wrapperdata-slide-typelock-screen17
tracks16
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
ease-in-out15
border-color15
data-slice-typebody15
gallery-video-background14
ahoversqs-slide-wrapperdata-slide-typelock-screen13
sqs-modal-lightbox-open13
p13
social-icons-style-solid12
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen12
0px12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen12
actionsnotstacked12
icon-wrapperhover12
password-style-rectangle11
password-style-underlined11
data-slice-typetwitter11
countdown-contentdata-formattextual11
actionsstacked11
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
squarespace10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typelock-screen10
lisqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typetwitternotdata-compound-type10
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typelock-screen10
110
solid10
0ms10
vimeo9
thedots9
tidal9
tumblr9
twitch9
twitter9
vevo9
rdio9
codepen9
behance9
bandsintown9
stumbleupon9
vsco9
yelp9
youtube9
applepodcast9
vine9
soundcloud9
stitcher9
googleplay9
meetup9
reddit9
medium9
linkedin9
itunes9
instagram9
imdb9
houzz9
google9
goodreads9
pinterest9
rss9
github9
smugmug9
flickr9
fivehundredpix9
facebook9
email9
snapchat9
dropbox9
dribbble9
spotify9
foursquare9
ease-in-out-ms-transitionbackground-color9
ease-in-outtransitionbackground-color9
ease-in-out-moz-transitionbackground-color9
ease-in-out-o-transitionbackground-color9
max-width600pxsqs-slide-wrapperdata-slide-typelock-screen8
sqs-slice-play-buttonicon-wrapper8
all8
data-slice-typealbumhover8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
show-track-title7
spansqs-slide-wrapperdata-slide-typelock-screen7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typelock-screen7
video-icon-style-border7
track7
social-icons-style-border7
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen7
button-style-outlinesqs-modal-lightbox7
input-wrappernothidden7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typelock-screen7
data-slice-typemap7
inputtypetextsqs-slide-wrapperdata-slide-typelock-screen7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen6
2em6
audio-player-icons-style-border6
button-style-raised6
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen6
10px6
audio-player-icons-style-solid6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
sqs-slice-play-buttonicon-wrapperhover6
input-wrapper6
ulsqs-slide-wrapperdata-slide-typelock-screen6
social-icons-style-regular6
track-progress-bar6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
vevohover5
houzzhover5
soundcloudhover5
reddithover5
googlehover5
vimeohover5
googleplayhover5
rsshover5
vinehover5
6px5
goodreadshover5
svgsocial-webkit-transitionbackground-color5
sqs-slice-album-playlistplaying5
imdbhover5
stitcherhover5
mediumhover5
meetuphover5
stumbleuponhover5
linkedinhover5
tidalhover5
ituneshover5
pinteresthover5
twitterhover5
tumblrhover5
spotifyhover5
rdiohover5
twitchhover5
instagramhover5
thedotshover5
audio-player-icons-style-regular5
squarespacehover5
githubhover5
dribbblehover5
01s5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
buttonsqs-slide-wrapperdata-slide-typelock-screen5
sqs-slide-layer-content5
lock-style-regular5
applepodcasthover5
tweet-timestamp5
bandsintownhover5
social-icons-style-knockout5
vscohover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typelock-screen5
codepenhover5
button-shape-pill5
behancehover5
button-shape-rounded-corners5
gmnoprint5
foursquarehover5
gm-style-cc5
flickrhover5
yelphover5
fivehundredpixhover5
youtubehover5
facebookhover5
smugmughover5
dropboxhover5
100ms5
emailhover5
ease-outopacity5
snapchathover5
tweet-body4
lock-style-border4
icon-wrapperwidth24pxheight24pxmargin04
neuearialsans-seriffont-weightnormalfont-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typelock-screen4
displaytablesqs-slide-wrapperdata-slide-typelock-screen4
form-itemsqs-slide-wrapperdata-slide-typelock-screen4
video-icon-style-solid4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typelock-screen4
5px4
audio-player-icons-style-knockout4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typelock-screen4
4px4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
video-icon-style-regular4
ulstacked4
map-style-minimal-dark4
track-title4
icon-wrapperwidth36pxheight36pxmargin03
use-iconfill000sqs-slide-wrapperdata-slide-typelock-screen3
inputtypepasswordsqs-slide-wrapperdata-slide-typelock-screen3
easesqs-slide-wrapperdata-slide-typelock-screen3
arrow-icon3
14px3
autoflex13
video-icon-style-knockout3
avisitedsqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-extra-smallsocial-icons-style-regular3
icon-wrapperborder2px3
lock-style-knockout3
fffsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill222background-color222sqs-slide-wrapperdata-slide-typelock-screen3
tweet-handle3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typelock-screen3
lock-style-solid3
tweet-display-name3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typelock-screen3
tweet-avatar3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typelock-screen3
autosqs-slide-wrapperdata-slide-typelock-screen3
sqs-modal-lightbox3
buttontypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typelock-screen3
button-style-solid3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-extra-largesocial-icons-style-solid3
social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
error-messagesqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-largesocial-icons-style-regular3
responsive-wrapper3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
actionssqs-slide-wrapperdata-slide-typelock-screen3
8px3
social-icons-size-extra-largesocial-icons-style-regular3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
sqs-slidesqs-slide-animation-ready3
social-icons-size-extra-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-knockout3
social-icons-size-extra-smallsocial-icons-style-solid3
social-icons-size-smallsocial-icons-style-border3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-smallsocial-icons-style-solid3
responsive-wrapperstackedtext-align-center3
social-icons-size-mediumsocial-icons-style-border3
social-icons-size-mediumsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-solid3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-largesocial-icons-style-border3
5emfont14px3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
social-icons-size-largesocial-icons-style-knockout3
responsive-wrappernotstacked3
social-icons-size-largesocial-icons-style-solid3
captcha-container-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
social-icons-size-extra-largesocial-icons-style-border3
adisplayblocksqs-slide-wrapperdata-slide-typelock-screen3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
ease-in-outtransitioncolor3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
use-iconfille0393esqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillff0031sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille6b91esqs-slide-wrapperdata-slide-typelock-screen3
only3
use-iconfill55aceesqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille4405fsqs-slide-wrapperdata-slide-typelock-screen3
sqs-slice-album-playliststacked3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillec4652sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill35465dsqs-slide-wrapperdata-slide-typelock-screen3
sqs-slice-album-playlistdemo-album3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typelock-screen3
3px3
button-play-pause3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperwidth28pxheight28pxmargin03
use-iconfillcc2127sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-mediumsocial-icons-style-regular3
use-iconfill006ed2sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperwidth32pxheight32pxmargin03
use-iconfillff4500sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillf60sqs-slide-wrapperdata-slide-typelock-screen3
7px3
screen3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typeheadingnotdata-compound-type3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typelock-screen3
ease-in-out-o-transitioncolor3
ease-in-out-ms-transitioncolor3
ease-in-out-moz-transitioncolor3
countdown-unit3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typegallerysqs-gallery-grid3
sqs-slide-containernotauto-image-background-color3
disclaimer-containersqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typelock-screen3
1px3
ease-in-moz-transitionopacity3
neuearialsans-seriffont-size14pxline-height13emtext-transformnoneletter-spacing05emfont-weightnormalfont-stylenormalcolor3a3a3asqs-slide-wrapperdata-slide-typelock-screen3
ease-in-ms-transitionopacity3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typelock-screen3
ease-in-o-transitionopacity3
ease-intransitionopacity3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille52d27sqs-slide-wrapperdata-slide-typelock-screen3
gallery-video-backgroundmobile3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillc41200sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillf94877sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillae995asqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill382110sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00b488sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-smallsocial-icons-style-regular3

Amore.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Amore.se is a scam?

Websites with Similar Names

Amore-architecture.vn
Công ty thiết kế nội thất nhà đẹp - Chuyên nghiệp số 1 tại Hà Nội
Amore-boutique.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Amore-cupcakes.com
amore-cupcakes.com
Amore-decor.com
Amore Decor & Event Consignment -  Where you can get your dream wedding at dream prices!!! We carry a large ever changing inventory of new and gently used wedding & event items  pre-owned designer, couture, discontinued samples and never before worn bridal gowns. Designers including: Maggie Sottero, Priscilla of Boston, Casablanca, Mori Lee, David's Bridal, Alfred Angelo, Michael Angelo, Jovanni...and so many more! We offer 50-80% off retail prices!!! We have a large variety of wedding & event items including:Bridal gowns - veils - Tiaras - Accessories - Jewelry - Shoes - Tuxes - Flower Girl dresses - Mothers dresses - Prom dresses- Younique  Makeup - It Works We want to find the perfect touches for your wedding at the perfect budget!!!We also offer   Rentals - Planning - Decorating - Cleaning Services (MAP IT ON CONTACT US PAGE)  Would you like to try Consignment?Going green, and saving on it is the way to go!!!Consignment is free and an easy way to sell all of your new and used items that you no-longer need!!! Thank You to all of our consignors that have help us help you find the right special touches for your special day!!! We know first hand how to build a beautiful wedding on a small budget!!!  
Amore-dh.net
Untitled Document
Amore-diamond.com
Amore Diamond

Recently Updated Websites

Brandsthatmakebank.com 2 seconds ago.66view.com 2 seconds ago.Azjones.info 2 seconds ago.Thoughtfix.com 2 seconds ago.Monicabellteam.org 3 seconds ago.Policecustody.com 3 seconds ago.Marijuana-arrests.com 3 seconds ago.Gottliebpaludan.com 3 seconds ago.Act-il.com 4 seconds ago.Travelfremont.com 4 seconds ago.Coryburke.ninja 5 seconds ago.Icaidubai.org 5 seconds ago.Balduin-store.com 6 seconds ago.Yamahawaterpurifier.com 6 seconds ago.Elissfarm.com 6 seconds ago.Saludagrade.net 6 seconds ago.Amicibrentwood.com 6 seconds ago.Mrcleanplumbingandheating.com 7 seconds ago.Justagirlfromaamchimumbai.com 7 seconds ago.Crysturbating.com 8 seconds ago.Trofeocidacos.com 8 seconds ago.Naturespot.org.uk 8 seconds ago.Mismasajistas.com 9 seconds ago.Thisismax.net 10 seconds ago.Style-gossip.com 11 seconds ago.3500noticias.com 11 seconds ago.Sdbbhof.com 12 seconds ago.Portforwardpodcast.com 12 seconds ago.Hlbrqyh.com 13 seconds ago.Tecnicaindustriale.it 13 seconds ago.