Amzblast.in


Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-29
Category: This site has not been categorized yet


Domain summary

Domain label
amzblast
Domain extension
in
Domain registered:
2016-09-24
Domain updated:
2020-10-29
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is amzblast.in ranked relative to other sites:

Percentage of visits to amzblast.in from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Amzblast.in registered?
A: Amzblast.in was registered 4 years, 2 months, 1 week, 3 days, 11 hours, 12 minutes, 59 seconds ago on Saturday, September 24, 2016.
Q: When was the WHOIS for Amzblast.in last updated?
A: The WHOIS entry was last updated 1 month, 6 days, 11 hours, 12 minutes, 59 seconds ago on Thursday, October 29, 2020.
Q: What are Amzblast.in's nameservers?
A: DNS for Amzblast.in is provided by the following nameservers:
  • ns67.domaincontrol.com
  • ns68.domaincontrol.com
Q: Who is the registrar for the Amzblast.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Amzblast.in?
A: Amzblast.in has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Amzblast.in each day?
A: Amzblast.in receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Amzblast.in resolve to?
A: Amzblast.in resolves to the IPv4 address 34.98.99.30.
Q: In what country are Amzblast.in servers located in?
A: Amzblast.in has servers located in the United States.
Q: What webserver software does Amzblast.in use?
A: Amzblast.in is powered by Openresty webserver.
Q: Who hosts Amzblast.in?
A: Amzblast.in is hosted by DoD Network Information Center in United States.
Q: How much is Amzblast.in worth?
A: Amzblast.in has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Amzblast.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Amzblast.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Amzblast.in

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Who hosts Amzblast.in?

Amzblast.in Hosting Provider Information

Hosted IP Address:34.98.99.30
Hosted Hostname:30.99.98.34.bc.googleusercontent.com
Service Provider:DoD Network Information Center
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:openresty

Is "DoD Network Information Center" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Amzblast.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Thu, 29 Oct 2020 08:40:21 GMT
Content-Type: text/html
Content-Length: 2522
Last-Modified: Thu, 29 Oct 2020 03:41:39 GMT
ETag: "5f9a39f3-9da"
X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAJRmzcpTevQqkWn6dJuX/N/Hxl7YxbOwy8 73ijqYSQEN WGxrruAKtZtliWC86 ewQ0msW1W8psOFL/b00zWqsCAwEAAQ_kKHMV qPgBuFc/DeZNDn2g67z21fBb/QIVm5RiV0lx2BxWs4 PQhg/hYF6mQ2jNELUEAp73rwUYXri1jyXCrHQ
Accept-Ranges: bytes
Via: 1.1 google

Amzblast.in Domain Nameserver Information

HostIP AddressCountry
ns67.domaincontrol.com 97.74.103.44
ns68.domaincontrol.com 173.201.71.44


Need to find out who hosts Amzblast.in?


Domain Registration (WhoIs) information for Amzblast.in

 Domain Name: amzblast.in
Registry Domain ID: D414400000001944697-IN
Registrar WHOIS Server:
Registrar URL: www.godaddy.com
Updated Date: 2020-10-06T15:44:35Z
Creation Date: 2016-09-24T16:06:48Z
Registry Expiry Date: 2020-09-24T16:06:48Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: autoRenewPeriod http://www.icann.org/epp#autoRenewPeriod
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Amz blast
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: Himachal Pradesh
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: IN
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please contact the Registrar listed above
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please contact the Registrar listed above
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please contact the Registrar listed above
Name Server: ns67.domaincontrol.com
Name Server: ns68.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-10-29T08:40:21Z

Websites with Similar Names

Amzblast.com
AMZ Blast - Start Selling Today | Easy Product Research

Recently Updated Websites

Lawsworthlp.com (3 seconds ago.)Insumosvite.com (4 seconds ago.)Lasorpresadeopalos.com (7 seconds ago.)Ldapp585.com (7 seconds ago.)Isdarrylhomeless.com (7 seconds ago.)Ldapp734.com (8 seconds ago.)Jovenesporelcambio.com (8 seconds ago.)Htxhungtien.com (12 seconds ago.)Jamiegibbonsstudio.com (12 seconds ago.)Ishikawas.com (12 seconds ago.)Ldapp770.com (12 seconds ago.)Iijertyu.com (14 seconds ago.)Kpppl.com (14 seconds ago.)Itronixsu.com (14 seconds ago.)Larotisserieducoin.com (15 seconds ago.)Jemmers-store.com (17 seconds ago.)La-vie-est-un-kiwi.com (18 seconds ago.)Kosmennada173city.com (19 seconds ago.)Jonathan-santurbano.com (20 seconds ago.)Krystalmed.com (21 seconds ago.)Ldapp583.com (23 seconds ago.)Lamplitertx.com (23 seconds ago.)Laundry-boxes.com (24 seconds ago.)Insidestoryhd.com (24 seconds ago.)Laecumene.com (25 seconds ago.)Jauneuni.com (29 seconds ago.)Itsmediagate.com (30 seconds ago.)Lazydogcrazydogs.com (31 seconds ago.)Ldapp690.com (31 seconds ago.)Joshuawards.com (31 seconds ago.)

Recently Searched Keywords

height documentreadyfunction (1 second ago.)color3f3f3fimportant (1 second ago.)летающие мечи врат дракона (2011) (1 second ago.)decorstyle (2 seconds ago.)itemstitlejuanitas tortilla chipslinktargetblanktypewixdatapageidchhjdtargetselftypepagelinkpagenamejuanitas (2 seconds ago.)eine sprechstunde mit charles cecil himself (2 seconds ago.)e99d (3 seconds ago.)生产基地 (3 seconds ago.)radio agora (4 seconds ago.)pray divine mercy chaplet pdf (5 seconds ago.)go dogs go (7 seconds ago.)deadlines and policies (10 seconds ago.)stylablebutton643855516label font-size (10 seconds ago.)parke (14 seconds ago.)板式文件柜 (15 seconds ago.)admin nbspnbspnbspnbspnbspnbspnbsp (15 seconds ago.)create event (16 seconds ago.)consultoría read more (16 seconds ago.)巨乳美乳 (16 seconds ago.)pistolas de silicona  (17 seconds ago.)buttoncomp-jvvknknm (18 seconds ago.)chiara (29 seconds ago.)1024px and min-width (36 seconds ago.)padding 0 background-color (39 seconds ago.)luxury bathrooms canberra (50 seconds ago.)au00f1o (51 seconds ago.)founding father (51 seconds ago.)dolce vita 8211 (54 seconds ago.)rss feed link open in new window (59 seconds ago.)sandy-area-rugs (1 minute 1 second ago.)