Artificial Intelligence, Big Data Analytics and Insight

Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: 12,719
Estimated Worth: $1,195,920
Category: This site has not been categorized yet

Analytics Insight is a leading media authority in artificial intelligence, big data, analytics, robotics covering the latest trends in the industry. Analytics Insight Magazine monitors developments, recognition, and achievements made by companies operating at the convergence of these technologies across the globe.



Domain summary

Last updated
2021-09-23
Domain label
analyticsinsight
Domain extension
net
Domain registered:
2016-05-04
Domain updated:
2019-03-16
Global Traffic Rank
12,719
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$1,195,920
Estimated daily income
$1,661
Estimated monthly income
$50,522

Frequently Asked Questions (FAQ)

Q: When was Analyticsinsight.net registered?
A: Analyticsinsight.net was registered 5 years, 5 months, 2 weeks, 7 hours, 1 minute, 47 seconds ago on Wednesday, May 4, 2016.
Q: When was the WHOIS for Analyticsinsight.net last updated?
A: The WHOIS entry was last updated 2 years, 7 months, 2 days, 7 hours, 1 minute, 47 seconds ago on Saturday, March 16, 2019.
Q: What are Analyticsinsight.net's nameservers?
A: DNS for Analyticsinsight.net is provided by the following nameservers:
  • ns23.domaincontrol.com
  • ns24.domaincontrol.com
Q: Who is the registrar for the Analyticsinsight.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Analyticsinsight.net?
A: Analyticsinsight.net ranks 12,719 globally on Alexa. Analyticsinsight.net has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Analyticsinsight.net each day?
A: Analyticsinsight.net receives approximately 138,376 visitors and 830,256 page impressions per day.
Q: What IP address does Analyticsinsight.net resolve to?
A: Analyticsinsight.net resolves to the IPv4 address .
Q: In what country are Analyticsinsight.net servers located in?
A: Analyticsinsight.net has servers located in the .
Q: What webserver software does Analyticsinsight.net use?
A: Analyticsinsight.net is powered by Apache webserver.
Q: Who hosts Analyticsinsight.net?
A: Analyticsinsight.net is hosted by Unknown in .
Q: How much is Analyticsinsight.net worth?
A: Analyticsinsight.net has an estimated worth of $1,195,920. An average daily income of approximately $1,661, which is roughly $50,522 per month.

Analyticsinsight.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Analyticsinsight.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Analyticsinsight.net

H1 Headings

0 :

H2 Headings

22 :
  1. TOP NEWS
  2. Nuro’s Artificial Intelligence Strategy on R2, A Self-Driving Car
  3. Exclusive Interview with Swapnil Deshpande, Chief Digital Officer, ThoughtWorks India
  4. Top Business Analytics Courses in Indian Colleges
  5. The Global Big Data Analytics Market is Expected to Reach US$420.98 Billion by 2027
  6. Top Computer Vision Jobs to Apply on September 23rd, 2021
  7. 10 Best Cryptocurrencies to buy in September for Big Benefits
  8. Dell Technologies Commissioned Research Reveals 53% of Businesses in India have not come close to realize their Digital Transformation Goals
  9. Bitcoin in 2050- Will Bitcoin Overtake Global Finance Soon?
  10. The 10 Most Valuable Cryptocurrencies of September 2021
  11. Top 5 Tech Stocks to Buy on September 23, 2021
  12. Latest News
  13. MAGAZINE
  14. Reports
  15. Analytics Insight Lists
  16. Podcast
  17. Research
  18. LATEST JOBS
  19. Analytics Insight Featured the Most Recognized Brands in the World
  20. Event and Media Partners
  21. TESTIMONIAL
  22. Sign up Now

H3 Headings

49 :
  1. Most Popular
  2. Articles
  3. FOLLOW US
  4. Breaking News
  5. Nuro’s Artificial Intelligence Strategy on R2, A Self-Driving Car
  6. Exclusive Interview with Swapnil Deshpande, Chief Digital Officer, ThoughtWorks India
  7. Top Business Analytics Courses in Indian Colleges
  8. The Global Big Data Analytics Market is Expected to Reach US$420.98 Billion by 2027
  9. Top Computer Vision Jobs to Apply on September 23rd, 2021
  10. 10 Best Cryptocurrencies to buy in September for Big Benefits
  11. Top Revolutionary Fintech Companies Transforming Business
  12. The 10 Most Impactful Women in Technology 2021 Vol-6
  13. The 10 Most Prominent Analytics and Data Science Institutes 2021
  14. Cryptocurrency Vendor Review
  15. RPA Vendor Analysis
  16. Artificial Intelligence
  17. Exclusive Interaction with V Chandrasekaran, Director and Co-Founder of Congruent Solutions
  18. Exclusive Interaction with Akshaya Bhargava, Chairman and Founder, Bridgeweave
  19. Exclusive Interaction with Sanjay Motwani, VP– APAC, Business Head of Legrand Data Center Solutions
  20. 80% of Companies will Adopt Intelligent Automation by 2025
  21. Data Science Education Market in India to Reach US$626 Million by 2025
  22. Analytics Insight Predicts Robotics and Cybersecurity to Create Over 13 million Job Opportunities by 2023
  23. Analytics Insight Predicts Disruptive Technologies Market to Reach US$1.9 Billion by 2023
  24. Analytics Insight Predicts 10,06,945 Job Openings in Artificial Intelligence in 2021
  25. Analytics Insight Predicts Artificial Intelligence Market at US$53.2 Billion in 2020, North America to Lead
  26. Industry
  27. Calling All Data Professionals: SQream Launches the Massive Data Video Challenge
  28. Market Trends
  29. Analytics and TikTok: How to use them for Success
  30. White Papers
  31. Domains in Which Artificial Intelligence is Rivalling Humans
  32. Computer Vision Engineer
  33. Computer Vision Digital Data
  34. Research Engineer-Computer Vision
  35. Computer Vision Systems Engineer
  36. Navigation- Sr. Robotics Engineer
  37. ROBOTICS ENGINEER
  38. Deep Thomas, Group Data and Analytics Cell
  39. TechVedika
  40. Michelle Johnson, Marketing Director
  41. Stephen Southin
  42. Magazines
  43. Most Popular
  44. E-Books
  45. Press Releases
  46. About Us
  47. LINKS
  48. Latest Issue
  49. Loading, Please Wait!

H4 Headings

22 :
  1. Top 10 Cryptocurrencies with Best Growth Potential in May 2021
  2. 5 Promising Cryptocurrencies that You Can Buy in May 2021
  3. Meet Shalu, Made in India: The First Female Humanoid Robot
  4. Nuro’s Artificial Intelligence Strategy on R2, A Self-Driving Car
  5. Exclusive Interview with Swapnil Deshpande, Chief Digital Officer, ThoughtWorks India
  6. Top Business Analytics Courses in Indian Colleges
  7. Top Revolutionary Fintech Companies Transforming Business in 2021
  8. The 10 Most Impactful Women in Technology 2021 Vol-6
  9. The 10 Most Prominent Analytics and Data Science Institutes 2021
  10. Top Influential Tech Leaders to Watch in 2021
  11. Nuro’s Artificial Intelligence Strategy on R2, A Self-Driving Car
  12. Exclusive Interview with Swapnil Deshpande, Chief Digital Officer, ThoughtWorks India
  13. Top Business Analytics Courses in Indian Colleges
  14. The Global Big Data Analytics Market is Expected to Reach US$420.98 Billion by 2027
  15. Top Computer Vision Jobs to Apply on September 23rd, 2021
  16. 10 Best Cryptocurrencies to buy in September for Big Benefits
  17. Top 20 B.Tech in Artificial Intelligence Institutes in India
  18. Top 10 Countries Leading the Artificial Intelligence Race
  19. Top 10 Robotics Companies in the World
  20. Genpact Launches Radio Analytics Engine to Accelerate Envision Virgin Racing’s Competitive Performance
  21. El Salvador Makes History: Will Bitcoin Bring it Prosperity?
  22. Indian Organizations Win Big in 18th Annual International Business Awards®

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

144 :

Google Adsense

:
pub-5237610503764271

Google Analytics

:
UA-107331590-1

Links - Internal

284:

Links - Internal (nofollow)

0:

Links - Outbound

16:

Links - Outbound (nofollow)

0:

Keyword Cloud for Analyticsinsight.net

processesintelligentveryseptember 23becoming mandatorytelegram channeldata analyticsbitcoinstrategy on r24 2021industriesthoughtworks indiaswapnil deshpandechief digital officerread more moreanalytics coursesaugustnbspnbspseptemberinstitutesdeshpande chiefswapnilexpectedartificial intelligence strategyjoininterview with swapnilworldartificialinsight predictstransformation latestdigital officer thoughtworksnbspnbspseptember 2323rdvisionviewanalytics marketintelligence latestcryptocurrency latest newsslideindex23 2021latest news podcastexclusivecarsmore insightslatest newsartificial intelligencebasedresearchnuros artificial intelligencedisclosedbenefits10 best cryptocurrencieschannel for moreglobal financeinsights joinnews topexclusiveread more viewbillionour telegrambestpodcastnuroscompaniesartificial intelligencebased startupus42098 billionlatest news selfdrivingfinanceacrosscreatesindustrynbsp join ourworld businesstrendslistmore latest news10 mostpredictsdata scienceapply on septemberjobs to applymagazineindiatechbig benefitscryptocurrenciesintelligenceintelligence strategymore view moreartificial intelligence latestmore viewpopular among companies2021nbsp nbsp joinglobal biglatest newstopofficer thoughtworks indiadirectorannualindianmore insights joinour telegram channeltechnologiesleaderslatestcryptocurrencyselfdriving carsamongbest cryptocurrenciesbusiness analytics coursesselfdrivingsciencebigcreates selfdrivingyou5techdriven world businessanalytics insightmorecomputer visionroboticsmostindian collegesworld business analyticsdigital transformation latestbecoming popularread more analyticscryptocurrencies to buymandatorypopularnews selfdrivingtelegramartificial intelligenceintelligent automationcourses are becomingtop computer visiondigital transformationnbsp joinvision jobsview moreanalytics latestbuycomputer vision jobsstrategyglobalamong companiesslideslength2021nbsp nbspmore digital transformationbillion by 2027indiaapplynews pressr2 a selfdrivingreadwejobs2021 latest newstop businessanalyticsunitednews podcastexclusivebeenreachbusinessesdeshpande chief digitalcomputercomputingcoursescollegesjquerypodcastexclusive interactionimportanttechdriven worldrevealsjoin ourfunctionseptember for bigmagazinesnewmore analytics insight2021 latestifbecomingmore cryptocurrencystartupdigital officernbsp0big data analyticscompanies and industriescars nuros artificialjob opportunitiesvarread more cryptocurrencytop listintobecoming popular amongselfdriving cars nurosseptember 23rd 2021automationbig dataread more latestchief digitalinteractiondisclosed indiaapplytheiropportunitiestransformationanalytics insight predictsmore digitalbusiness analyticsmaydigitalr2databuy in septemberinsightsbusiness analytics latest1techdrivenofficermakingbusinessnowreports7made62expected to reachtransformation is becoming3selfdriving carintelligencebased startuptop computermarket is expectednexclusive interview2021nbspintelligencebasedpressus42098deshpandehavemarketnewsrecentseptembertop business analyticsindiaapply nowreach us42098newstopcourses in indianchiefdocumenttopswapnil deshpande chieflatest news topmore morethoughtworkscars nurosofficer thoughtworks23rd 2021popular amongreach us42098 billionmore analyticstechnologyyourhasnuros artificialchannelmore latestcreates selfdriving cars8latest news press4disclosed indiaapply nowcryptocurrency latestusglobal big datajobfirstintelligence latest newsseptember 23 2021news podcastexclusive interactionmore cryptocurrency latestshowslidesslideindexdata analytics marketjoin our telegramseptember 23rdstartup that createsinsightinterviewread moreread more digitalapplypodcastexclusive10 bestcarour

Longtail Keyword Density for Analyticsinsight.net

KeywordsOccurences
business analytics courses8
big data analytics7
latest news top7
data analytics market6
global big data6
interview with swapnil5
cryptocurrency latest news5
digital officer thoughtworks5
chief digital officer5
deshpande chief digital5
swapnil deshpande chief5
courses in indian5
artificial intelligence latest5
intelligence latest news5
r2 a self-driving5
strategy on r25
artificial intelligence strategy5
channel for more4
more insights join4
disclosed indiaapply now4
september for big4
buy in september4
more analytics insight4
cryptocurrencies to buy4
join our telegram4
market is expected4
expected to reach4
reach us42098 billion4
computer vision jobs4
our telegram channel4
nbsp join our4
read more analytics4
apply on september4
digital transformation latest4
analytics insight predicts4
more view more4
read more view4
more cryptocurrency latest4
2021 latest news4
read more cryptocurrency4
jobs to apply4
read more digital3
more latest news3
more digital transformation3
read more latest3
latest news podcastexclusive3
news podcastexclusive interaction3
read more more3
10 best cryptocurrencies3
september 23rd 20213
self-driving cars nuros3
top computer vision3
companies and industries3
latest news self-driving3
artificial intelligence-based startup3
startup that creates3
creates self-driving cars3
september 23 20213
transformation is becoming3
becoming popular among3
popular among companies3
business analytics latest3
billion by 20273
tech-driven world business3
world business analytics3
courses are becoming3
2021nbsp nbsp join3
cars nuros artificial3
nuros artificial intelligence3
officer thoughtworks india3
top business analytics3
latest news press3
latest news30
read more29
artificial intelligence20
computer vision15
big data14
business analytics13
analytics insight11
nbspnbspseptember 2310
digital transformation9
news top8
analytics courses8
self-driving cars7
data analytics7
cryptocurrency latest6
view more6
analytics market6
global big6
best cryptocurrencies6
deshpande chief5
officer thoughtworks5
digital officer5
chief digital5
tech-driven world5
10 most5
big benefits5
swapnil deshpande5
intelligence strategy5
intelligence latest5
disclosed indiaapply5
more cryptocurrency4
more view4
september 23rd4
vision jobs4
us42098 billion4
reach us420984
more analytics4
insight predicts4
indiaapply now4
insights join4
more insights4
telegram channel4
our telegram4
join our4
latest newstop4
data science4
top list4
2021 latest4
news self-driving4
september 234
nbsp join4
transformation latest4
top business3
more digital3
2021nbsp nbsp3
intelligent automation3
more more3
becoming mandatory3
4 20213
podcastexclusive interaction3
news podcastexclusive3
cars nuros3
nuros artificial3
more latest3
artificial intelligence-based3
job opportunities3
intelligence-based startup3
creates self-driving3
indian colleges3
self-driving car3
global finance3
23 20213
exclusive interview3
10 best3
23rd 20213
becoming popular3
popular among3
top computer3
among companies3
analytics latest3
thoughtworks india3
world business3
news press3
more48
analytics42
latest40
news36
read30
data28
artificial24
022
intelligence21
big21
business21
september19
digital18
top17
insight15
vision15
computer15
self-driving14
114
india12
transformation12
cryptocurrencies12
211
311
world11
var10
nbspnbspseptember10
market10
our10
cryptocurrency9
function9
most9
global9
courses8
insights8
join8
best8
bitcoin8
companies8
r27
now7
becoming7
reach7
cars7
us6
jobs6
tech-driven6
billion6
interview6
disclosed6
we6
has6
view6
robotics6
buy6
thoughtworks5
important5
apply5
benefits5
reports5
technologies5
research5
businesses5
popular5
indiaapply5
you5
deshpande5
magazines5
officer5
nbsp5
45
strategy5
job5
chief5
swapnil5
indian5
predicts4
n4
processes4
very4
23rd4
into4
their4
been4
document4
us420984
august4
expected4
tech4
computing4
science4
automation4
list4
may4
startup4
newstop4
telegram4
channel4
jquery4
united4
leaders3
new3
director3
making3
made3
trends3
53
63
podcast3
nuros3
podcastexclusive3
intelligent3
car3
slideindex3
showslidesslideindex3
exclusive3
slideslength3
press3
73
interaction3
recent3
first3
industries3
institutes3
technology3
have3
industry3
2021nbsp3
magazine3
mandatory3
reveals3
among3
finance3
annual3
creates3
opportunities3
colleges3
your3
intelligence-based3
if3
83
across3

Who hosts Analyticsinsight.net?

Analyticsinsight.net Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Apache

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%

HTTP Header Analysis for Analyticsinsight.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 23 Sep 2021 12:19:34 GMT
Server: Apache
X-Pingback: https://www.analyticsinsight.net/xmlrpc.php
Link:; rel="https://api.w.org/", ; rel="alternate"; type="application/json", ; rel=shortlink
Expires: Tue, 01 Jan 2000 00:00:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, max-age=0, post-check=0, pre-check=0
Pragma: no-cache
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Thu, 23 Sep 2021 12:19:34 GMT
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Referrer-Policy: no-referrer-when-downgrade
Content-Length: 42763
Content-Type: text/html; charset=UTF-8

Analyticsinsight.net Domain Nameserver Information

HostIP AddressCountry
ns23.domaincontrol.com 97.74.101.12
ns24.domaincontrol.com 173.201.69.12


Need to find out who hosts Analyticsinsight.net?


Domain Registration (WhoIs) information for Analyticsinsight.net

 Domain Name: analyticsinsight.net
Registry Domain ID: 2025839032_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-03-03T05:58:32Z
Creation Date: 2016-05-04T15:03:31Z
Registrar Registration Expiration Date: 2023-05-04T15:03:31Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Stravium Intelligence LLP
Registrant State/Province: Andaman and Nicobar Islands
Registrant Country: IN
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=analyticsinsight.net
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=analyticsinsight.net
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=analyticsinsight.net
Name Server: NS23.DOMAINCONTROL.COM
Name Server: NS24.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-08-29T21:00:00Z

Websites with Similar Names

Analy.co
สมาคมต่อมไร้ท่อแห่งประเทศไทย
Analy4dom01.com
ようこそ
Analyacespedes.com
Home | analyacespedes
Analyatransfer.online
analyatransfer.online - Yapım Aşamasında - guzel.net.tr
Analycase.com
analycase.com -&nbspanalycase Resources and Information.
Analycits.com
Analycits -

Recently Updated Websites

Becmechanical.com (2 seconds ago.)Graduationattire.co.uk (3 seconds ago.)Magicstagefx.com (4 seconds ago.)Alarmmonitoring4u.com (4 seconds ago.)Alward2000.com (6 seconds ago.)Jazz1601.com (7 seconds ago.)Bluesatmoonlight.com (8 seconds ago.)Caibet250.app (9 seconds ago.)Corelwindow.com (9 seconds ago.)Tts-bikeshop.de (12 seconds ago.)Birretesytogas.com.mx (12 seconds ago.)Weeklybliss.com (15 seconds ago.)Yayubet3858.com (16 seconds ago.)Hotspringsextreme.com (17 seconds ago.)Selfbeauty.com (18 seconds ago.)Maximilian-igl.com (19 seconds ago.)Kokreta.com (19 seconds ago.)Menchiesmutts.com (21 seconds ago.)Mitchelletteandassociates.com (25 seconds ago.)Ultrasecureproduct.com (27 seconds ago.)Deadseabeauties.com (28 seconds ago.)Rosstucker.com (29 seconds ago.)Kook-zonder-e.nl (33 seconds ago.)Sakhibihar.com (34 seconds ago.)Omalleyreels.com (36 seconds ago.)Aviamor.com (38 seconds ago.)Tmo-vandenburg.com (41 seconds ago.)Casideal.com (42 seconds ago.)Ultracorepowersupplements.com (43 seconds ago.)Paulsonfoundation.com (43 seconds ago.)

Recently Searched Keywords

relations and functions (1 second ago.)join my quiz (2 seconds ago.)qut xt nghim (2 seconds ago.)qut xt (5 seconds ago.)qut khoa y (7 seconds ago.)tiendanimal valencia (8 seconds ago.)qut khoa ngoi (9 seconds ago.)noip蒟蒻的 (10 seconds ago.)qut khoa (11 seconds ago.)income tax login (11 seconds ago.)pht kp (13 seconds ago.)territory occupied panama (15 seconds ago.)phongkhamtaman (15 seconds ago.)11:52 futebol 7: autor de 3 gols, vascaíno dão foi eleito o melhor em campo na vitória sobre o bangu (17 seconds ago.)review-widget-title (18 seconds ago.)ph sn khoa (18 seconds ago.)demokrati (19 seconds ago.)jav free (20 seconds ago.)scripture union (20 seconds ago.)u0110tu01b0 tmu1ea1i (22 seconds ago.)japanese innocent mom (22 seconds ago.)гмо (24 seconds ago.)innuendo (26 seconds ago.)milf porn (26 seconds ago.)help public relations (26 seconds ago.)lascana сумка в mini-format с съемный ... (27 seconds ago.)sensus fidelium youtube (32 seconds ago.)contul meu medicover (36 seconds ago.)korean bj (36 seconds ago.)up before (38 seconds ago.)