Ancestry.de  |  Ahnenforschung, Stammbaum und familiengeschichtliche Aufzeichnungen auf Ancestry.de
Low trust score  | 
Ancestry.de bietet historische Daten und Dokumente für Ahnenforschung. Erstellung eines Familienstammbaums online und Informationen und Tipps rund um die Ahnenforschung und Genealogie.




Ancestry.de Website Information

Website Ranks & Scores for Ancestry.de

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:46,188
Majestic Rank Majestic Rank:262,323
Domain Authority Domain Authority:55%
DMOZ DMOZ Listing:No

Whois information for ancestry.de

Full Whois Lookup for Ancestry.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Ancestry.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: ancestry.de
Nserver: ns-1176.awsdns-19.org
Nserver: ns-1747.awsdns-26.co.uk
Nserver: ns-473.awsdns-59.com
Nserver: ns-685.awsdns-21.net
Status: connect
Changed: 2017-09-27T01:48:27+02:00

[Tech-C]
Type: PERSON
Name: Domain Administrator
Organisation: Ancestry.com Operations Inc.
Address: 360 W 4800 N
PostalCode: 84604
City: Provo
CountryCode: US
Phone: +1.8017057947
Fax: +1.8017057001
Email: Login to show email
2012-12-18T17:41:02+01:00

[Zone-C]
Type: PERSON
Name: Domain Admin
Organisation: MarkMonitor Inc
Address: 3540 East Longwing Lane
Address: Suite 300
PostalCode: 83646
City: Meridian
CountryCode: US
Phone: +1.2083895740
Fax: +1.2083895771
Email: Login to show email
2017-06-05T17:55:26+02:00

Who hosts Ancestry.de?

Ancestry.de is hosted by Myfamily.com, Inc. in Utah, Provo, United States, 84604.
Ancestry.de has an IP Address of 66.43.22.183 and a hostname of ance4stry.com.



Ancestry.de Web Server Information

Hosted IP Address:66.43.22.183
Hosted Hostname:ance4stry.com
Service Provider:Myfamily.com, Inc.
Hosted Country:United StatesUS
Location Latitude:40.3393
Location Longitude:-111.5709
Webserver Software:Not Applicable

HTTP Header Analysis for Ancestry.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/7.5
X-AspNetMvc-Version: 3.0
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
X-UA-Compatible: IE=Edge
Date: Fri, 03 Jul 2015 17:21:05 GMT
Connection: Keep-Alive
Content-Length: 10740
Vary: Accept-Encoding
Content-Encoding: gzip


Need to find out who hosts Ancestry.de?

Ancestry.de Free SEO Report

Website Inpage Analysis for Ancestry.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Ancestry.de

padding40pxnorepeat backgroundpositioncenterjetztdelohpbenefitgrid2delohpcontactgrid contactcolihremarginleft15pxtop0colorfffdokumentebackgroundsizecoverdelohpheaderdelohpcontactemailbackgroundposition100color9cbe30delohpherosectionmargintop0floatrightdelohpbenefitlistmargintop15px1margintop12pxmedia onlymargintop30pxmargintop35pxleftautoscrollingdelohpquotesimgwirvonlineheight1emfontsize18pxpadding15pxunsdelohpcontent padding0positionabsolute top50screenfreinem0pxmediadelohpherotitlemarginleft0delohphowsteps howsteptitlemedia only screensmplogincalloutlineheightnormalmarginleft10pxpadding0ihremdieclearbothdelohpbenefitcolpadding0 20pxdelohpvaluesgrid valuescoldelohpcontentfontweightboldanccoldelohpcontactgridlohpfooterwrapheight70pxfontsize30pxzumargintop20pxancestryancloginbtndelohptvcolpadding0pxmargintop40pxsmpancheaderverticalalignmiddledelohphowsteps howstepcontentdelohpvaluesgrid delohpcontactgriddelohpbenefitgrid delohpbenefitgrid2unseredashowsteptitledelohpmainbackgroundcolorfff0margintop10pxdelohpiconsprite backgroundposition0delohpfooterlogodisplayblockvardelohpvaluesgriddelohphowstepsdelohpquotestitledelohpfooter delohpcontentanothoverdelohpquotessectionjetzt startenhowstepnorepeatdelohpfooterlogowrapdelohpvaluessectionlohpexpfooter anccolonlydelohpheroctawraplohpexpfootervaluescol delohpcontactgrid contactcoldelohphowsectionfunctiondelohpvaluesgrid delohpiconspritepbackgroundposition05pxcolorfff displayinlineblockcontactcolbeidelohpquotescredit20pxtopautolohpfooterlegalvaluescolleft0top0 0startenfontsize28pxfamiliengeschichtedelohpquotesintrofontsize38pxdelohpbenefitgridweltweitmargin0heightautobackgroundpositioncenterlidelohpfootermaxwidth100delohpcontent heightinheritfontsize25pxhorzologoberaufsiepadding40px 0derdelohpfootersocialdisplayinlineblockmargintop45pxstammbaumpositionrelativewidth100valuescol delohpcontactgriddelohpcontactintrobackgroundpositioncenter toptop50positionabsolutevorfahrensmphdrlinkswrapheightinheritpositionrelative topautodelohpiconspritedelohphowtreesimgnorepeat backgroundpositioncenter topdelohpvaluesgrid valuescol delohpcontactgridmaxwidth767pxautodisplaynonelifirstchildtextaligncenterdelohpcontactsectionifphoneheadlinevaluescoltitlebackgroundcolorf8f7f3only screenmargin0 autoscreen and maxwidth767pxfloatleft

Longtail Keyword Density for Ancestry.de

KeywordsOccurences
media only screen14
screen and max-width767px3
no-repeat background-positioncenter top3
delohpvaluesgrid valuescol delohpcontactgrid3
valuescol delohpcontactgrid contactcol3
media only14
only screen14
delohphowsteps howstep8
0 07
margin0 auto6
delohpcontent padding05
background-positioncenter top5
delohpfooter delohpcontent5
no-repeat background-positioncenter4
delohpvaluesgrid delohpiconsprite4
valuescol delohpcontactgrid3
lohpexpfooter anccol3
positionrelative topauto3
padding0 20px3
delohpcontactgrid contactcol3
positionabsolute top503
delohpvaluesgrid valuescol3
delohpvaluesgrid delohpcontactgrid3
delohpcontent heightinherit3
delohphowsteps howsteptitle3
delohpiconsprite background-position03
padding40px 03
delohpbenefitgrid delohpbenefitgrid23
colorfff displayinline-block3
jetzt starten3
035
text-aligncenter18
displayblock18
positionrelative16
width10016
delohpvaluesgrid15
delohphowsteps15
delohpfootersocial15
only14
media14
screen14
displayinline-block14
delohpbenefitgrid13
delohpiconsprite12
vertical-alignmiddle12
sie12
delohpcontent12
lohpexpfooter11
auto10
20px10
delohpbenefitlist9
die9
color9cbe308
padding08
howstep8
colorfff8
function8
margin-top07
line-heightnormal7
delohpfooter7
background-position07
displaynone7
ancestry7
margin07
delohpmain7
wir6
auf6
positionabsolute6
delohpcontactgrid6
background-positioncenter6
background-colorfff6
anccol6
no-repeat6
lohpfooterlegal6
delohpherosection6
floatright5
delohpquotessection5
familiengeschichte5
clearboth5
-5px5
delohpbenefitcol5
margin-top10px5
floatleft5
li5
background-position1005
smphdrlinkswrap5
delohpherotitle5
delohpheader5
delohpheroctawrap5
top5
valuescoltitle4
fr4
delohpcontactsection4
delohpvaluessection4
if4
unsere4
delohpcontactintro4
von4
delohpfooterlogowrap4
0px4
weltweit4
ber4
margin-top20px4
stammbaum4
ihre4
zu4
dokumente4
leftauto4
scrolling4
margin-top30px4
font-size28px4
horzologo4
top04
margin-left10px4
padding40px4
line-height1em4
ancloginbtn4
padding15px4
jetzt3
starten3
das3
margin-top15px3
phoneheadline3
margin-left15px3
font-size18px3
content3
smplogincallout3
13
lifirst-child3
ihrem3
lohpfooterwrap3
vorfahren3
einem3
left03
der3
bei3
height70px3
smpancheader3
uns3
max-width1003
var3
margin-top12px3
topauto3
anothover3
delohptvcol3
heightinherit3
delohphowtreesimg3
delohpquotesimg3
delohpquotestitle3
delohpquotesintro3
delohpquotescredit3
margin-top35px3
howsteptitle3
top503
valuescol3
contactcol3
margin-top40px3
delohphowsection3
delohpbenefitgrid23
max-width767px3
delohpcontactemail3
font-weightbold3
p3
delohpfooterlogo3
5px3
background-colorf8f7f33
font-size38px3
margin-left03
margin-top45px3
padding0px3
heightauto3
font-size25px3
background-sizecover3
font-size30px3

What are the nameservers for ancestry.de?

Ancestry.de Domain Nameserver Information

HostIP AddressCountry
ns1.p49.dynect.net 208.78.70.49United States United States
ns2.p49.dynect.net 204.13.250.49United States United States
ns3.p49.dynect.net 208.78.71.49United States United States
ns4.p49.dynect.net 204.13.251.49United States United States

Ancestry.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Ancestry.de is a scam?