Angellparkspeedway.net

Checking...
Angell Park Speedway
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
angellparkspeedway
Domain extension
net
Domain registered:
2013-05-03
Domain updated:
2019-05-04
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is angellparkspeedway.net ranked relative to other sites:

Percentage of visits to angellparkspeedway.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Angellparkspeedway.net registered?
A: Angellparkspeedway.net was registered 7 years, 4 months, 3 weeks, 8 hours, 57 minutes, 30 seconds ago on Friday, May 3, 2013.
Q: When was the WHOIS for Angellparkspeedway.net last updated?
A: The WHOIS entry was last updated 1 year, 4 months, 2 weeks, 6 days, 8 hours, 57 minutes, 30 seconds ago on Saturday, May 4, 2019.
Q: What are Angellparkspeedway.net's nameservers?
A: DNS for Angellparkspeedway.net is provided by the following nameservers:
  • ns1.firethorndev3.com
  • ns2.firethorndev3.com
Q: Who is the registrar for the Angellparkspeedway.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Angellparkspeedway.net?
A: Angellparkspeedway.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Angellparkspeedway.net each day?
A: Angellparkspeedway.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Angellparkspeedway.net resolve to?
A: Angellparkspeedway.net resolves to the IPv4 address 173.231.200.231.
Q: In what country are Angellparkspeedway.net servers located in?
A: Angellparkspeedway.net has servers located in the United States.
Q: What webserver software does Angellparkspeedway.net use?
A: Angellparkspeedway.net is powered by Apache webserver.
Q: Who hosts Angellparkspeedway.net?
A: Angellparkspeedway.net is hosted by tzulo, inc. in California, El Segundo, United States, 90245.
Q: How much is Angellparkspeedway.net worth?
A: Angellparkspeedway.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Angellparkspeedway.net?

Angellparkspeedway.net Hosting Provider Information

Hosted IP Address:173.231.200.231
Hosted Hostname:cc4891.inmotionhosting.com
Service Provider:tzulo, inc.
Hosted Country:United StatesUS
Location Latitude:33.9214
Location Longitude:-118.413
Webserver Software:Apache

Is "tzulo, inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Angellparkspeedway.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 09 Sep 2020 12:23:04 GMT
Server: Apache
Vary: Accept-Encoding,Cookie
Last-Modified: Wed, 09 Sep 2020 12:03:02 GMT
Accept-Ranges: bytes
Content-Length: 11752
Cache-Control: max-age=3, must-revalidate
Expires: Wed, 09 Sep 2020 12:23:07 GMT
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip

Angellparkspeedway.net Domain Nameserver Information

HostIP AddressCountry
ns1.firethorndev3.com 162.144.94.165United States United States
ns2.firethorndev3.com 162.144.142.240United States United States


Need to find out who hosts Angellparkspeedway.net?


WhoIs information for Angellparkspeedway.net

 Domain Name: ANGELLPARKSPEEDWAY.NET
Registry Domain ID: 1798685036_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-05-04T10:08:28Z
Creation Date: 2013-05-03T18:32:12Z
Registrar Registration Expiration Date: 2021-05-03T18:32:12Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization:
Registrant State/Province: Wisconsin
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ANGELLPARKSPEEDWAY.NET
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ANGELLPARKSPEEDWAY.NET
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ANGELLPARKSPEEDWAY.NET
Name Server: NS1.FIRETHORNDEV3.COM
Name Server: NS2.FIRETHORNDEV3.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-05-01T01:00:00Z

Angellparkspeedway.net Free SEO Report

Website Inpage Analysis for Angellparkspeedway.net

H1 Headings

0 :

H2 Headings

5 :
  1. Miller Lite Corn fest August 23rd Postponed
  2. Angell Park June Races & Pepsi Nationals Postponed
  3. Angell Park May Races Postponed
  4. Iconic Angell Park Speedway Roars into 2020
  5. Sunday, September 1st Season Championship / Kevin Doty Classic

H3 Headings

1 :
  1. Featured News

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

27 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

32:
  1. Home
    http://www.angellparkspeedway.net/
  2. News
    http://www.angellparkspeedway.net/news/
  3. Special Events
    http://www.angellparkspeedway.net/special-events-at-angell-park-speedway/
  4. 2020 Schedule
    http://www.angellparkspeedway.net/schedule/
  5. Tickets
    http://www.angellparkspeedway.net/fan-info/tickets/
  6. Directions
    http://www.angellparkspeedway.net/fan-info/directions/
  7. Lodging
    http://www.angellparkspeedway.net/fan-info/lodging/
  8. FAQ’s
    http://www.angellparkspeedway.net/fan-info/faqs/
  9. Track Info
    http://www.angellparkspeedway.net/fan-info/track-info/
  10. Divisions
    http://www.angellparkspeedway.net/fan-info/divisions/
  11. 2018
    http://www.angellparkspeedway.net/multimedia/photos/2018-2/
  12. 2017
    http://www.angellparkspeedway.net/multimedia/photos/2017-2/
  13. 2016
    http://www.angellparkspeedway.net/multimedia/photos/2016-2/
  14. Videos
    http://www.angellparkspeedway.net/multimedia/videos/
  15. History
    http://www.angellparkspeedway.net/history/
  16. Sponsors
    http://www.angellparkspeedway.net/sponsors/
  17. Information
    http://www.angellparkspeedway.net/pavilion-rental/info/
  18. Photos
    http://www.angellparkspeedway.net/pavilion-rental/photos/
  19. Contact
    http://www.angellparkspeedway.net/contact/
  20. No text
    http://www.angellparkspeedway.net/schedule/
  21. No text
    http://www.angellparkspeedway.net/miller-lite-corn-fest-august-23rd-postponed/
  22. Miller Lite Corn fest August 23rd Postponed
    http://www.angellparkspeedway.net/miller-lite-corn-fest-august-23rd-postponed/
  23. admin
    http://www.angellparkspeedway.net/author/admin/
  24. No text
    http://www.angellparkspeedway.net/angell-park-june-races-pepsi-nationals-postponed/
  25. Angell Park June Races & Pepsi Nationals Postponed
    http://www.angellparkspeedway.net/angell-park-june-races-pepsi-nationals-postponed/
  26. No text
    http://www.angellparkspeedway.net/angell-park-may-races-postponed/
  27. Angell Park May Races Postponed
    http://www.angellparkspeedway.net/angell-park-may-races-postponed/
  28. No text
    http://www.angellparkspeedway.net/iconic-angell-park-speedway-roars-into-2020/
  29. Iconic Angell Park Speedway Roars into 2020
    http://www.angellparkspeedway.net/iconic-angell-park-speedway-roars-into-2020/
  30. No text
    http://www.angellparkspeedway.net/sunday-september-1st-season-ending-championship-kevin-doty-classic/
  31. Sunday, September 1st Season Championship / Kevin Doty Classic
    http://www.angellparkspeedway.net/sunday-september-1st-season-ending-championship-kevin-doty-classic/
  32. Next Page »
    http://www.angellparkspeedway.net/page/2/

Links - Internal (nofollow)

0:

Links - Outbound

11:
  1. No text
    http://www.rockauto.com/index.php?a=AngellParkSpeedway
  2. No text
    http://www.weatherforyou.com/weather/wisconsin/sun+prairie.html
  3. Site Design
    http://www.firethornmarketing.com
  4. Firethorn Marketing
    http://www.firethornmarketing.com
  5. No text
    http://www.firethornmarketing.com
  6. No text
    https://facebook.com/pages/Angell-Park-Speedway/102341476593008?fref=ts
  7. No text
    http://youtube.com/#
  8. No text
    https://twitter.com/AngellPark
  9. No text
    https://twitter.com/intent/follow?screen_name=AngellPark
  10. No text
    http://AngellPark
  11. No text
    https://statcounter.com/

Links - Outbound (nofollow)

0:

Keyword Cloud for Angellparkspeedway.net

urlrndseasonposted by adminbackgroundposition 50pxwindowabkw varmayvar abkwvar abkw windowabkwjquerywindowloadfunctionpostponenorepeat transparentwidth150pxadminangell parkangellapbcarouseldefaultprev22pxspecialapbcarouseldefaultnextrightaugustpostponed postedweangell park speedwaybackgroundpositionabkw windowabkwnextbackgroundposition 0speedwaydisplaydocumentwritejuneparkforcedsundayitemsbackground0 varwindowabkwracesautoseptemberurl httpwwwangellparkspeedwaynetwpcontentpluginscarousellayoutscarouseldefaultimagespngvisibilityvarhttpwwwangellparkspeedwaynetwpcontentpluginscarousellayoutscarouseldefaultimagespngleft0ongoingbackground url httpwwwangellparkspeedwaynetwpcontentpluginscarousellayoutscarouseldefaultimagespngtransparentnorepeathelliprestrictionsabkwstate2postponedabkw windowabkw vartruepostedpark speedwaydisplay blockblockbackground url

Longtail Keyword Density for Angellparkspeedway.net

KeywordsOccurences
posted by admin5
background url httpwwwangellparkspeedwaynetwp-contentpluginscarousellayoutscarouseldefaultimagespng4
angell park speedway4
var abkw windowabkw3
abkw windowabkw var3
angell park8
0 var7
display block4
background url4
url httpwwwangellparkspeedwaynetwp-contentpluginscarousellayoutscarouseldefaultimagespng4
no-repeat transparent4
background-position 04
background-position -50px4
park speedway4
var abkw3
abkw windowabkw3
windowabkw var3
postponed posted3
var24
020
110
park10
-50px8
background-position8
angell8
true7
left6
auto6
sunday5
hellip5
speedway5
admin5
posted5
visibility4
rnd4
august4
june4
races4
abkw4
-22px4
background4
jquerywindowloadfunction4
items4
width4
apbcarouseldefaultprev4
display4
block4
apbcarouseldefaultnext4
httpwwwangellparkspeedwaynetwp-contentpluginscarousellayoutscarouseldefaultimagespng4
url4
transparent4
no-repeat4
23
season3
may3
state3
next3
september3
postponed3
we3
windowabkw3
postpone3
forced3
right3
documentwrite3
restrictions3
ongoing3
special3

Angellparkspeedway.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Angellparkspeedway.net is a scam?

Websites with Similar Names

Angel-444.com
快三玩法-推荐
Angel-a.su
Юридический портал Angel-a.su
Angel-above-graphic-design.com
Angel Above Graphic Design | Lake County, IL
Angel-academy.org
Angel-Academy – Vom Leiden ins Leben.
Angel-adoption.com
Angel Adoption
Angel-agency.com
Domain suspended
Angel-alayon.net
Angel Alayón | Ideas, libros, economía y algo más…
Angel-ambassadors.org
Angel Ambassadors – Social Media Agency 2019 Blog

Recently Updated Websites

Edinburgrenbandb.com 16 seconds ago.Pharmbazar.com 17 seconds ago.Czechvoyage.com 17 seconds ago.Kartikads.com 17 seconds ago.Projectrestore.us 18 seconds ago.Mystudio104.com 21 seconds ago.Cafeinbet.com 23 seconds ago.Shoppingcidade.net 23 seconds ago.Stgeorgembc.com.au 25 seconds ago.Softdevtools.com 25 seconds ago.Milagrowhumantech.com 25 seconds ago.Masumoto.info 27 seconds ago.Hotyogasantee.com 28 seconds ago.Couragetoovercome.net 29 seconds ago.Mainlyusedforwalking.tumblr.com 29 seconds ago.Autsol.in 30 seconds ago.Ariesbnb.com 30 seconds ago.Baronapipelines.com 30 seconds ago.Melendezforsenate.com 30 seconds ago.Ameritec.com 30 seconds ago.Caribbeanresort.com 30 seconds ago.Kathleenmartelphotography.com 31 seconds ago.Thecabhawaii.com 31 seconds ago.163gq.com 31 seconds ago.Renuca.com 32 seconds ago.Ronjennings.net 32 seconds ago.Apanetoclean.com 32 seconds ago.Literacyandnumeracyforadults.com 32 seconds ago.Fffbioworks.com 33 seconds ago.Kissmegreen.com 33 seconds ago.