Appcelerator.com Website Analysis Summary

Appcelerator.com  |  Appcelerator is the only mobile app development platform that enables companies to create, deliver and analyze their mobile apps.
Low trust score  | 
Home - Appcelerator | The Mobile First Platform


Rank
197,449
Rating
F
Trust Score
Low Trust Score
Estimated worth
$63,600
Estimated daily income
$106
Estimated monthly income
$3,224
Backlinks
0

Appcelerator.com has a Low Trust Score, and a Statvoo Rank of F.

Appcelerator.com is hosted by Amazon.com, Inc. in Oregon, Portland, United States, 97086.
Appcelerator.com has an IP Address of 54.244.244.126 and a hostname of ec2-54-244-244-126.us-west-2.compute.amazonaw.

The domain appcelerator.com was registered 1 decade 2 years 6 months ago by , it was last modified 6 years 9 months 4 days ago and currently is set to expire 2 years 6 months 1 week ago.

It is the world's 197,449 most popular site among over 300 million websites.

Appcelerator.com has a total of 0 backlinks.

Appcelerator.com gets approximately 6,294 unique visitors a day and 42,340 pageviews per day.

Appcelerator.com has an estimated worth of $63,600.
An average daily income of approximately $106, which is wroughly $3,224 per month.

Whois information for appcelerator.com

Full Whois Lookup for Appcelerator.com Whois Lookup

Domain Name: APPCELERATOR.COM
Registry Domain ID: 1075360085_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.safenames.net
Registrar URL: http://www.safenames.net
Updated Date: 2017-04-25T05:00:37Z
Creation Date: 2007-07-09T14:31:06Z
Registry Expiry Date: 2018-07-09T14:31:06Z
Registrar: SafeNames Ltd
Registrar IANA ID: 447
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS-1185.AWSDNS-20.ORG
Name Server: NS-1588.AWSDNS-06.CO.UK
Name Server: NS-460.AWSDNS-57.COM
Name Server: NS-806.AWSDNS-36.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-15T09:57:45Z

Who hosts Appcelerator.com?

Appcelerator.com Web Server Information

Hosted IP Address:54.244.244.126
Hosted Hostname:ec2-54-244-244-126.us-west-2.compute.amazonaw
Service Provider:Amazon.com, Inc.
Hosted Country:United StatesUS
Location Latitude:45.5234
Location Longitude:-122.676
Webserver Software:Not Applicable

HTTP Header Analysis for Appcelerator.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 11 Jun 2015 21:30:49 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: close
Last-Modified: Thu, 11 Jun 2015 20:55:21 GMT
Content-Encoding: gzip
Vary: Accept-Encoding
X-Pingback: http://www.appcelerator.com/xmlrpc.php
X-Frame-Options: ALLOW-FROM https://www.optimizely.com

Need to find out who hosts Appcelerator.com?

Appcelerator.com Free SEO Report

Website Inpage Analysis for Appcelerator.com

H1 Headings:3
Build great mobile experiences faster
Everything you need to create great, native mobile apps—all from a single JavaScript code base.
Open to All!
H2 Headings:3
The cross-platform power of Titanium plus direct access to any native API with Hyperloop – now available to everyone for free!
API Builder
Loved by developers, trusted by enterprise
H3 Headings:10
Hyperloop.
API Builder.
Analytics.
Mobilize your data in minutes. Really.
Engine of mobile innovation
Connecting Devs
Holidays in hand
Social, local, mobile
A wealth of data
Greatest tracks
H4 Headings:3
Build
Connect
Measure
H5 Headings:8
Fully Native
Dev Powered
Mobilize Any Data
Big ROI
Better Apps, Faster
Open & Extensible
Visibility & Agility
Industry Standard
H6 Headings:1
Start free, grow from there.
Total IFRAMEs:1
Total Images:28
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Appcelerator.com

deliverdisplayicondeveloper portal helpubuilderourcodeproductapp uprotocolanalytics1developer portalmoreshowcaseyourappcelerator platformcustomersexperienceshelpmarginleft0greatplaygithubhttpsstore googleblockcontactapp store googleportal help appfunctiondeveloperbetterstore google playnativepricingapp app storeampyougoogle playanyhelp appmarketplaceapimedia0innovationvisibilityapp storeminuteshelp app ueventsappsappceleratorgetapp appplatformwidthreadcenterapi buildermiddle multicolumnustitaniumu marketplace eventsapp u marketplacemobile appsenterprisemulticolumndevelopersinitfnflagslidearrowget the appfreebuildopengooglevarallu marketplacefalsedataoverviewportalmobilemarketplace eventsappmiddleagilitynewhyperlooptruestoresignupcompanyblogfasterportal help

Longtail Keyword Density for Appcelerator.com

KeywordsOccurences
app app store5
app store google5
store google play5
get the app5
u marketplace events3
portal help app3
help app u3
app u marketplace3
developer portal help3
app app5
app store5
store google5
appcelerator platform5
google play5
developer portal4
mobile apps3
middle multi-column3
help app3
portal help3
app u3
u marketplace3
marketplace events3
api builder3
multi-column38
mobile18
app16
appcelerator12
var12
platform10
apps8
us7
developer7
google6
06
protocol6
get6
amp6
any5
data5
15
our5
store5
build5
native5
play5
enterprise5
customers5
product5
help4
company4
your4
portal4
icon4
titanium4
api4
read4
more4
true4
false4
great4
block4
marketplace4
deliver4
slide4
better3
initfnflag3
all3
visibility3
innovation3
https3
overview3
agility3
showcase3
function3
you3
width3
display3
center3
middle3
margin-left03
contact3
blog3
developers3
free3
u3
events3
pricing3
media3
experiences3
code3
minutes3
arrow3
hyperloop3
builder3
new3
github3
faster3
analytics3
sign3
up3
open3

What are the nameservers for appcelerator.com?

Appcelerator.com Domain Nameserver Information

HostIP AddressCountry
ns-1155.awsdns-16.org 205.251.196.131United States United States
ns-127.awsdns-15.com 205.251.192.127United States United States
ns-1801.awsdns-33.co.uk 205.251.199.9United States United States
ns-972.awsdns-57.net 205.251.195.204United States United States

Appcelerator.com Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Appcelerator.com is a scam?