ARACNE Co | Clothing Store

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

ARACNE Co | Streetwear Clothing Store | Shameless Fearless Reckless | MX



Domain summary

Last updated
2021-04-17
Domain label
aracne
Domain extension
shop
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Aracne.shop registered?
A: Aracne.shop was registered 7 months, 2 weeks, 5 days, 1 hour, 53 minutes, 6 seconds ago on Saturday, April 17, 2021.
Q: When was the WHOIS for Aracne.shop last updated?
A: The WHOIS entry was last updated 7 months, 2 weeks, 5 days, 1 hour, 53 minutes, 6 seconds ago on Saturday, April 17, 2021.
Q: What are Aracne.shop's nameservers?
A: DNS for Aracne.shop is provided by the following nameservers:
  • ns1.wixdns.net
  • ns0.wixdns.net
Q: Who is the registrar for the Aracne.shop domain?
A: The domain has been registered at .
Q: What is the traffic rank for Aracne.shop?
A: Aracne.shop has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Aracne.shop each day?
A: Aracne.shop receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Aracne.shop resolve to?
A: Aracne.shop resolves to the IPv4 address 185.230.63.171.
Q: In what country are Aracne.shop servers located in?
A: Aracne.shop has servers located in the United States.
Q: What webserver software does Aracne.shop use?
A: Aracne.shop is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Aracne.shop?
A: Aracne.shop is hosted by Fara Negar Pardaz Khuzestan in Virginia, Ashburn, United States, 20147.
Q: How much is Aracne.shop worth?
A: Aracne.shop has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Aracne.shop Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Aracne.shop Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Aracne.shop

H1 Headings

0 :

H2 Headings

12 :
  1. welcome
  2. to the 
  3. world of
  4. aracne
  5. RECK
  6. LESS
  7. SHAME
  8. LESS
  9. fEAR
  10. LESS
  11. NEW RELeaSES

H3 Headings

3 :
  1. HEAVEN Graphic Tee
  2. EVOL Graphic Tee
  3. New World Graphic Tee

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

5 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Aracne.shop

stylejzl0z2mjitem600pxinputbackgroundffffffcolor2e302ffontnormal normal normalstylekb1o5vysnavcontainerleftdirection80ms lineareaseinoutbordercolor 2scounter2290669049rootsort2347269111dropdown dropdown3980268547dropdowncontentnormal 16px20px wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtextdecoration4px 0 rgba000147 06borderwidth1pxcompjnlht6ba10px 10px 10pxdropdown2713770132dropdowndropdown3980268547contentvisible dropdownbase3644427161rootcompjnlht6ba47 07bordercolorrgba46 48streetwear clothing storemargin0 4px14px 0stylekb1mtp19dropdown stylekb1mtp19dropdownwrappercoloroption2215770673coloroption12px14em brandongrotw01lightsansserifcompjnlht6ba dropdown2713770132rootdropdown2713770132mobilemxmetakeywordsseopagetitleseodropdownoption3572813792titlecompjnlht6ba dropdownoption978924491dropdownoption216 214compjnlht6bastorehidetitletrueicondescriptionseoaracneproximanw01regsansseriftextdecoration compjnlht6barecklesscolorffffffbackgroundcolorrgba50 50selectfocusquantitycounter1985873316quantitycounterquantitycounter1985873316customizedrgba0001backgroundcolorrgba255 255stylekb1rljallabelwrapperrgba0 71paddingtop10pxnormal normal normalpagination1936884330rootpagination1936884330rtlbackgroundcolorcolorffffffbackgroundcolorrgba50 50 50stylekb1mtp19languagebuttonicon16px15em brandongrotw01lightsansseriftextdecoration compjnlht6baselectdataerrortrue255 07compjnlht6banormal 14px20pxstylejzl0z2mjsubmenu1 stylejzl0z2mjmenucontainerpaddingtop calc10020px15em brandongrotw01lightsansseriftextdecoration980px 05tooltip2361669277tpaarrowright0width7pxheight12px14px1 brandongrotw01lightsansseriftextdecoration compjnlht6bastore shamelessaracneclothing store48 47 06fontnormalprodevicemobilenormal 14px14em5pxkakucalc100compjnlht6banormal 15px18px wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtextdecorationpopover3126000425popoverdataplacementbottom07bordercolorrgba46 4848 47 07bordercolorrgba46255 1 stylekb1o5vysnavcontainernormal 16px14em brandongrotw01lightsansseriftextdecoration1pxrgba255 255 2559stylejzl0z2mjitem backgroundcolorrgba255 255stylekb1o5vysnavcontainer48 47 042compjnlht6bafearless recklessnormal 12px14emdropdownbase3644427161rootcompjnlht6ba dropdownoption978924491dropdownoptionpopover3126000425popoverdataplacementtoptooltip2361669277popoveranimationenteropacity0transformscale90 14pxmargin0 14pxstylekb1ewpczlabelwrapper0px calc10px 0pxstylekb1mtp19dropdownwrapper4px 8px2normal 20px15em14px20px0 4px48 47 03compjnlht6bagothic prosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0 4pxnormal normal 15px14emtooltip2361669277tpaarrowdisplayblockpositionabsolutemargin00 0stylekb1mtp19languagebuttonrightbuttonnext868628899contentmargin0 autotextoverflowellipsiswhitespacenowrapoverflowhiddenco streetwear06fontnormalstylekb1mtp19dropdownnormal 15px14em brandongrotw01lightsansseriftextdecorationstoreinputpadding0border0textaligncenterwidth10071 186bordercolorrgb217 216b0b0b0dropdown2713770132dropdown dropdownbase3644427161rootnormal 14px1 brandongrotw01lightsansseriftextdecoration20px15em brandongrotw01lightsansseriftextdecoration compjnlht6badropdownbase3644427161root14px14em brandongrotw01lightsansserifcompjnlht6ba16px20px2n0ktxtnew ul186bordercolorrgb21718214backgroundrgb0colorrgb217pathfill2e302fcompjnlht6ba11dropdownbase3644427161rootcompjnlht6bacounter2290669049btn pathfill2e302fcompjnlht6ba255 255 07colorrgba46popover3126000425popoverdataplacementright07compjnlht6ba255 1autostylekb1o5vysnavcontainerarrowstylekb1o5vysnavcontainerleftdirection48 47 07compjnlht6bareckless mxmetakeywordsseopagetitleseo aracnesort2347269111dropdownstylejzl0z2mjmenucontainercenterdirectionoverflowhidden53 1borderwidth0pxborderradius10px8pxselectdatapreviewfocuseaseinoutcolorrgba000120 014px143emstylekb1o5vysrepeaterbuttonlabelsort770459381sort dropdown2713770132dropdown dropdownbase3644427161rootcompjnlht6ba02compjnlht6ba devicemobilew3hiragino kakuboxsizingborderboxbordertop1px solideaseinoutbordercolorco clothing216 214backgroundrgb0 711borderwidth0pxborderradius10px 10px 10px255 255 1popover3126000425popoverdataplacementleft07colorrgba255 255neuestylejzl0z2mjmenucontainerarrow stylejzl0z2mjmenucontainersvgcontainerpro w3hiragino kakulinearapplyopacity 80msdropdownbase3644427161rootcompjnlht6ba sort770459381sort dropdown2713770132dropdown15px14em brandongrotw01lightsansseriftextdecoration compjnlht6ba07bordercolorrgba46 48 470 rgba000120 0nstylekb1ewpczlinkpadding02boaq10zvw06fontnormal normal normalpopover3126000425arrowborderwidth5pxstylejzl0z2mjmenucontainerarrowstylejzl0z2mjmenucontainerrightdirectioncubicbezier25464594transformscale1 translatey00 rgba0001helveticaneuew0155roma helveticaneuew0255romadropdownoption978924491dropdownoption dropdown2713770132dropdown dropdownbase3644427161rootcompjnlht6batooltip2361669277roottranslatey3px04s ease53compjnlht6banormal normal 14px14empositionfixed importantleftautostylekb1mtp19languagebuttonleftstoretypemetapropsnamedescriptioncontentaracne co25em14pxpopover3126000425popoverdataplacementrighttooltip2361669277witharrowpaddingleft6pxpopover3126000425popoverdataplacementrighttooltip2361669277popoveranimationenteropacity0transformscale9 translatex10px07colorrgba46 48pathfilldf3131backgroundcolorrgba255 255 25525em 006fontnormal normalultxtnewrgba0futuraltw01booksansseriftextdecorationcompjnlht6ba dropdownoption3572813792rootnotdropdownoption3572813792selectableultxtnew ol3x2qsoliddropdownoption978924491dropdownoption dropdown2713770132dropdowndropdown3980268547contentvisible8px 0 rgba000120popover3126000425popoverdataplacementtop16px1 brandongrotw01lightsansseriftextdecoration compjnlht6ba2zthn2ahc6borderstylesolidbordercolorrgba249 24914px143em brandongrotw01lightsansseriftextdecorationdropdown2713770132dropdown dropdownbase3644427161rootcompjnlht6ba dropdownoption978924491dropdownoptionpopover3126000425popovercontentbackgroundcolordf3131border1pxol ulrgba0 016px14em brandongrotw01lightsansseriftextdecorationstorepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildren aracne conormal 20px15em brandongrotw01lightsansseriftextdecoration48 47 15gothic prosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0selectdatapreviewerror stylekb1o5vysnavcontainerarrowbrandongrotw01lightsansseriftextdecorationinputmscleardisplaynone0px 16pxcompjnlht6ba39 53 1borderwidth0pxborderradius10pxcolorneue helveticaneuew0155romawfont938663868d996c1a9240ddaca30003fb0312ccwf868d996c1a9240ddaca30003forigtsblockboldinputtypenumbermozappearancetextfieldrgba000120 0 4pxstylejzl0z2mjitem borderradius012pxborder1px 757575042compjnlht6badropdownoption3572813792rootnotdropdownoption3572813792selectable1translatey0 translatex01hm3padding0importantol47 06compjnlht6ba03compjnlht6baboxsizingborderboxbordertop1pxpopover3126000425popoverdataplacementlefttooltip2361669277popoveranimationenteropacity0transformscale90px calc10pxcubicbezier25464594applyopacity 120ms cubicbezier25464594transformscale1normal normal 14px1stylejzl0z2mjmenucontainerarrow1bordersolidshameless fearlessborderright0helveticahelveticaneuew1055roma16px14em brandongrotw01lightsansserifdropdown2713770132dropdown dropdownbase3644427161rootcompjnlht6ba sort770459381sortulnormal normal 20px15empopover3126000425popoverdataplacementrighttooltip2361669277popoveranimationenteropacity0transformscale947 042compjnlht6bapopover3126000425popoverdataplacementbottomtooltip2361669277popoveranimationenteropacity0transformscale9varmaxwidthnormalfillffffffnormal normal 16px14emmxmetakeywordsseopagetitleseo aracnergba2553sc7knotonlyoftypelastoftypeoldirrtlwkgi0normal normal12px14em brandongrotw01lightsansserifcompjnlht6bacubicbezier25464594transformscale1marginleft calc100storepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildren aracne0 0 1pxmargin0lineheightnormalletterspacingnormalpositionabsolutetop0left0color373737width100height100stylejzl0z2mjsubmenu stylejzl0z2mjitem0s15px14em brandongrotw01lightsansseriftextdecorationinputbackgroundffffffcolor2e302ffontnormal normalco clothing storepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildren07colorrgba255 255 2551backgroundcolorrgba255 255 255borderstylesolidbordercolorrgba249w3hiraginorgba0 71 186prosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0 4pxsolidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelvetica2s easeinoutcolor 2s14px144em brandongrotw01lightsansseriftextdecoration compjnlht6babrandongrotw01lightsansseriftextdecoration compjnlht6bastylekb1mtp19languagebuttonlastchild47 07bordercolorrgba46popover3126000425popoverdataplacementright tooltip2361669277tpaarrowleft0width7pxheight12pxsort770459381sort dropdown2713770132dropdownnormal 16px15em07colorrgba46 48 4717counter2290669049btndropdown2713770132dropdowndropdown3980268547contentvisible dropdownbase3644427161rootcompjnlht6ba sort770459381sorttopautobottom0color ffffffstorehidetitletrueicondescriptionseoaracne co streetwearcounter2290669049inputwrapperflex1normal 14px20px brandongrotw01lightsansserifcompjnlht6bastylekb1mtp19languagebuttonlabelstylekb1mtp19languagebuttonhastextcubicbezier25464594applyopacityimportantzindex500px04snormal 16px15em brandongrotw01lightsansserifcompjnlht6bastoretypemetapropsnamedescriptioncontentaracneboxsizingborderboxbordertop1px solid rgba0186bordercolorrgb217 216255 07colorrgba46 48tooltip2361669277tpaarrow pathfilldf3131inputbackgroundffffffcolor2e302ffontnormalselectdatapreviewhover5emmargin25emmarginleft4px stylekb1mtp19languagebuttoncenter000proximanw01regsansseriftextdecoration12pxborder1px 757575 solidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelveticastylekb1mtp19languagebuttonnormal 14px116px15emstylekb1mtp19languagebuttoniconstylekb1mtp19languagebuttonhasiconmargin0lineheightnormalletterspacingnormal txtnewstreetwear clothingborderwidth2pxbordercolorrgba204 20416px10 rgba000120helveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romastreetwear clothing storehidetitletrueicondescriptionseoaracne2zthn2yocq255 255colorrgb217 216 214backgroundrgb0borderstylesolidbordercolorrgba249 249 249dropdown2713770132dropdowndropdown3980268547contentvisible100 4px 053 1borderwidth0pxborderradius10px 10pxdropdownbase3644427161rootcompjnlht6ba sort770459381sortsvg02compjnlht6bacubicbezier25464594applyopacity 120ms06compjnlht6bapopover3126000425popoverdataplacementtop tooltip2361669277tpaarrowbottom0width12pxheight7pxcalc10pxnormal normal 16px15emstore shameless fearlesspopover3126000425popoverdataplacementtooltip2361669277popoveranimationexitopacity1transformscale1 translatey00 0 050 50brandongrotw01lightsansseriffuturaltw01booksansseriftextdecoration compjnlht6ba16px20px wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtextdecorationcounter2290669049btnbackground0 0padding6pxborder0cursorpointernormal normal 16px1helveticaneuew0255romaclothing store shamelessstylekb1o5vysnavcontainerarrow stylekb1o5vysnavcontainersvgcontainer12px14empopover3126000425popovercontentbackgroundcolor212121padding4px 12pxborder1px14stylekb1o5vysnavcontainerarrowstylekb1o5vysnavcontainerrightdirectionhelveticaneuew1055roma helveticatransparent1px 1px47 06fontnormal normalhelveticaneuew0255roma helveticaneuew1055romatranslatey053 1selecthoverhelveticaneuew0155romabrandongrotw01lightsansserif color2e302fclothing storehidetitletrueicondescriptionseoaracne0 16pxcompjnlht6babrandongrotw01lightsansseriffontnormalpopover3126000425popovercontentbackgroundcolor212121padding4px 12pxborder1px 7575751borderwidth0pxborderradius10px 10pxstylekb1mtp19horizontalcolorpickeritem2561287067radioouterboxshadow0stylekb1rljallinknormal 14px143em brandongrotw01lightsansseriftextdecoration24px133emnormal 15px18pxrgba000120colorffffffbackgroundcolorrgba50marginleft calc100 980px186compjnlht6bacolorrgb0 71neuehelveticaarialmeiryoautotextoverflowellipsiswhitespacenowrapoverflowhidden15px18px wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtextdecoration20pxpopover3126000425popoverdataplacementbottom tooltip2361669277tpaarrowtop0width12pxheight7pxrgba46 48 47216 214inputwebkitinnerspinbuttonwebkitappearancenonemargin04px 0reckless mxmetakeywordsseopagetitleseofontnormal normal normalkaku gothic prosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0normal normal 14px20px71 186displaynonedropdown3980268547dropdowncontentnormal 16px20pxgothicshamelessease 0s16px1 brandongrotw01lightsansseriftextdecorationdropdown2713770132dropdowndropdown3980268547contentvisible dropdownbase3644427161rootcompjnlht6ba dropdownoption978924491dropdownoptionstylekb1ewpczlabeltooltip2361669277tpaarrowtop0width12pxheight7pxstoretypemetapropsnamedescriptioncontentaracne co streetwearwfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtextdecoration colorrgb0 71world16pxcobackgroundcolor ffffff80ms linearapplyopacity 80mslinearapplyopacity 80ms linearstylejzl0z2mjlabelprosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0normal 15px14emfearless1backgroundcolorrgba255 2551jm7t249 1backgroundcolorrgba255stylekb1rljallabel80ms linearapplyopacitycubicbezier25464594transformscale1 translatey0 translatex0tooltip2361669277tpaarrowbottom0width12pxheight7pxstylejzl0z2mjmenucontainerleftdirectionsolid rgba0selectpopover3126000425popovercontentbackgroundcolor212121padding4px10px 10pxwfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtextdecoration colorrgb0popover3126000425popoverdataplacementtoptooltip2361669277witharrowpaddingbottom6pxaracne copagination3499236751rootpagination1936884330rtlpositionabsolutetop0right0bottom0left0popover3126000425popoverdataplacementlefttooltip2361669277popoveranimationenteropacity0transformscale9 translatex10pxstorehidetitletrueicondescriptionseoaracne copopover3126000425popoverdataplacementtooltip2361669277popoveranimationexittooltip2361669277popoveranimationexitactiveopacity0transitiontransformpagination3499236751root2z3nhbrandongrotw01lightsansseriftextdecoration compjnlht6ba dropdownoption3572813792rootnotdropdownoption3572813792selectable757575 solidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelveticaeaseinoutbordercolor 2s easeinoutcolor0padding6pxborder0cursorpointerboxsizingborderboxborderwidth2pxbordercolorrgba2042seasecolorrgb217 216solidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelvetica neuehelveticaarialmeiryoopacityminwidth1emminheight1emlineheight1emjustifycontentcenteralignitemscenterpadding5em4px 8px 012pxnormal 16px14em brandongrotw01lightsansserif48 4714px1 brandongrotw01lightsansseriftextdecorationtooltip2361669277tpaarrowleft0width7pxheight12px3rqkm15px14em07colorrgba255neuehelveticaarialmeiryo pro w3hiraginoproximanw01regsansserif color2e302f1backgroundcolorrgba255clothing storehidetitletrueicondescriptionseoaracne coborderradius0dropdown2713770132dropdown dropdown3980268547dropdowncontentbrandongrotw01lightsansseriffontnormal normal120ms cubicbezier25464594applyopacityco clothing storetypemetapropsnamedescriptioncontentaracnestylekb1mtp19mobilelanguageselectorfontnormalpositionfixed importantleftauto importantzindex50helveticaneuew1055roma helvetica arialnewpopover3126000425popoverdataplacementbottomtooltip2361669277witharrowpaddingtop6pxnormal bold39 53compjnlht6bakaku gothiccounter2290669049btnbackground0font normalwfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtextdecoration colorrgb217 216255 1 stylejzl0z2mjmenucontainer1borderwidth0pxborderradius10pxlinearffffff35se255 07colorrgba46757575 solidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelvetica neuehelveticaarialmeiryo255 255 07compjnlht6bapopover3126000425popoverdataplacementbottomtooltip2361669277popoveranimationenteropacity0transformscale9 translatey3pxmaxwidth 600pxnormal 16px1stylejzl0z2mjmenucontainerrgba46wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtextdecoration colorrgb21739 53 116px15em brandongrotw01lightsansserifcompjnlht6banormal 16px14em47 06fontnormalstylejzl0z2mjmenucontainerarrowstylejzl0z2mjmenucontainercenterdirection214compjnlht6bafearless reckless mxmetakeywordsseopagetitleseopopover3126000425popovercontentbackgroundcolordf3131border1px solid rgba25525525525graphic14px143em brandongrotw01lightsansseriftextdecoration compjnlht6ba980pxstylejzl0z2mjmenucontainersvgcontainerimportant 3x2qcalc100 980px 05123 110tooltip2361669277tpaarrow svgdisplayblockcolorpickeritem2561287067radiooutercompjnlht6ba120msopacityminwidth1emminheight1emlineheight1emjustifycontentcenteralignitemscenterpadding5em 5emmargin25emsvgcolordf3131normal 14px144em brandongrotw01lightsansseriftextdecoration216 214backgroundrgb014px144em brandongrotw01lightsansseriftextdecoration2s easeinoutcolorsvgdisplayblockproximanw01regsansserifnormal normal 14px143emdropdownerror2927302832rootstylekb1mtp19languagebuttoncentersolid rgba255255255253x2q 2z3nhlinearapplyopacitydropdownbase3644427161rootcompjnlht6ba dropdownoption978924491dropdownoption dropdown2713770132dropdownstylejzl0z2mjitemhoverareafirstchild07bordercolorrgba46stylekb1o5vysnavcontainersvgcontainerco streetwear clothing04s ease 0spagination2327321151navbutton80msaracne co clothingcounter2290669049btndisabledcursordefaultstylejzl0z2mjmenucontainerrightdirectioncolorpickeritem2561287067radioouterboxshadow0 0colorrgb0neuehelveticaarialmeiryo prostylekb1mtp19languagebuttoncenterstylekb1mtp19languagebuttonhorizontal0normal normal 15px18pxdropdownnativeselect1597652001erroriconpopover3126000425popoverdataplacementtooltip2361669277popoveranimationexitopacity1transformscale1 translatey0 translatex0txtnew249 249colorpicker1196641707itemnormal normal 14px144emcolor2e302frgba0 0 01px rgba46stylekb1mtp19languagebuttonarrowicon120ms cubicbezier25464594transformscale1helveticaneuew0255roma helveticaneuew1055roma helveticaclothing storetypemetapropsnamedescriptioncontentaracne2s easeinoutbordercolorcolorpickeritem2561287067radioouterboxshadow0 0 0translatex006borderwidth1pxcompjnlht6ba15stylekb1mtp19currentlanguagenormal 14px143emborderwidth2pxbordercolorrgba204 204 204popover3126000425popoverdataplacementlefttooltip2361669277witharrowpaddingright6px2zthnshameless fearless recklessstylekb1mtp19languagebuttonspacerpagination2327321151navbuttonpagination2327321151disabledrgba25525525525normal normal 12px14em120ms cubicbezier25464594transformscale1 translatey0249 249 1backgroundcolorrgba255brandongrotw01lightsansserifcompjnlht6ba dropdown2713770132rootdropdown2713770132mobilepagination2327321151slashbrandongrotw01lightsansserifcompjnlht6bastylekb1mtp19languagebuttonlabelstylekb1mtp19languagebuttonhastext margin0neue helveticaneuew0155roma helveticaneuew0255romabuttonnext868628899contentmargin047 07compjnlht6baborderleft0borderbottomleftradius0borderbottomrightradius0translatex10px14px12s easeinoutbordercolor 2spopover3126000425popoverdataplacementtooltip2361669277popoveranimationentertooltip2361669277popoveranimationenteractiveopacity1transitiontransform 120ms cubicbezier25464594applyopacitydropdownoption978924491dropdownoption dropdown2713770132dropdowndropdown3980268547contentvisible dropdownbase3644427161rootcompjnlht6ba14px144em48 47 06borderwidth1pxcompjnlht6ba2zthn 3rqkmdropdown2713770132rootdropdown2713770132mobile120ms cubicbezier25464594applyopacity 120ms71 186compjnlht6bapopover3126000425popoverdataplacementtooltip2361669277popoveranimationentertooltip2361669277popoveranimationenteractiveopacity1transitiontransformpathborderwidth2px borderstylesolidbordercolorrgba249popover3126000425popoverdataplacementtooltip2361669277popoveranimationexittooltip2361669277popoveranimationexitactiveopacity0transitiontransform 80ms8solid transparentdropdown2713770132dropdownnormal normal 16px20pxdropdownbase3644427161rootbutton2197027860upgradeselectdatapreviewerrorstorepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildreneaseinoutcolor 2sstreetwearborderwidth2px borderstylesolidbordercolorrgba249 249clothing storetypemetapropsnamedescriptioncontentaracne co1px rgba46 48rgba46 48margin0 14px 0inputwebkitouterspinbuttondropdown2713770132dropdownoptionboldrgba255 255dropdownoption978924491dropdownoption dropdown2713770132dropdownbuttonnext868628899contentoverflowvisibletextoverflowunsetwhitespaceunsetwfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtextdecoration193uackclothing storepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildrenhelvetica arial07colorrgba46font normal normalclothing storepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemkb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildren aracnedropdown2713770132dropdown dropdownbase3644427161rootcompjnlht6banormal 14px14em brandongrotw01lightsansserifcompjnlht6baarial13contentsolidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelvetica neuehelveticaarialmeiryo profont05fffstylekb1o5vysnavcontainercenterdirectionstylejzl0z2mjitem backgroundcolorrgba25520px15em249 1backgroundcolorrgba255 25539 53tooltip2361669277tpaarrow15px18pxpopover3126000425popoverdataplacementtoptooltip2361669277popoveranimationenteropacity0transformscale9 translatey3px47 148 47 06compjnlht6ba8px 0tu3borderwidth2pxpopover3126000425popovercontentbackgroundcolordf3131border1px solidmargin0normal 16px1 brandongrotw01lightsansseriftextdecoration16px14emdropdownoption3572813792titlecompjnlht6bapopover3126000425popoverdataplacementtooltip2361669277popoveranimationexitopacity1transformscale1709positionfixed15px18px wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtextdecoration colorrgb217stylekb1o5vysnavcontainerarrowstylekb1o5vysnavcontainercenterdirectionsolid rgba0 7116px15em brandongrotw01lightsansseriftextdecoration7pxsort770459381sort dropdown2713770132dropdowndropdown3980268547contentvisible4pxsort770459381sortw3hiragino kaku gothicbrandongrotw01lightsansseriffontnormal normal normal16pxcompjnlht6bastylekb1o5vysnavcontainerarrow3sc7knotonlyoftypefirstoftype14px20px brandongrotw01lightsansserifcompjnlht6ba47 03compjnlht6bapro w3hiraginofontnormal normalstylejzl0z2mjitemhoverarealastchild1 stylekb1o5vysnavcontainerbackgroundcolorrgba25571 186bordercolorrgb217counter2290669049btndisabled214backgroundrgb0 71normal 16px15em brandongrotw01lightsansseriftextdecoration416px14em brandongrotw01lightsansseriftextdecoration compjnlht6bapopover3126000425popoverdataplacementleft tooltip2361669277tpaarrowright0width7pxheight12pxpath fillffffffimportantleftauto16sort770459381sort dropdown2713770132dropdowndropdown3980268547contentvisible dropdownbase3644427161rootcompjnlht6bastylekb1o5vysnavcontainerrightdirectionpagination1936884330root0 1px6dropdownoption978924491dropdownoptionimportantleftauto importantzindex501px 16pxcompjnlht6banormal 12px14em brandongrotw01lightsansserifcompjnlht6bapopover3126000425popoverdataplacementtooltip2361669277popoveranimationentertooltip2361669277popoveranimationenteractiveopacity1transitiontransform 120msstylekb1mtp19languagebuttoniconstylekb1mtp19languagebuttonhasicon margin0clothingselectdatapreviewerror stylejzl0z2mjmenucontainerarrowstylejzl0z2mjmenucontainerarrowstylejzl0z2mjmenucontainerleftdirection12pxborder1pxmxmetakeywordsseopagetitleseo aracne copopover3126000425popoverdataplacementtooltip2361669277popoveranimationexittooltip2361669277popoveranimationexitactiveopacity0transitiontransform 80ms linearapplyopacityquantitycounter1985873316quantitycounter204 204transparent transparentcalc10px 0pxifal12stylejzl0z2mjsubmenubefore3ds0zcalc100 980pxnormal 14px144emprosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0 4px 8px14px14em

Longtail Keyword Density for Aracne.shop

KeywordsOccurences
calc100 980px 0522
margin-left calc100 980px22
normal normal 16px14em16
47 06fontnormal normal16
48 47 06fontnormal16
normal normal normal15
normal normal 14px14em15
06fontnormal normal normal14
255 255 112
co streetwear clothing11
font normal normal11
normal normal 16px15em11
04s ease 0s11
normal normal 15px14em10
48 47 03comp-jnlht6ba10
rgba46 48 4710
normal 15px14em brandon-grot-w01-lightsans-seriftext-decoration10
15px14em brandon-grot-w01-lightsans-seriftext-decoration comp-jnlht6ba10
normal 16px1 brandon-grot-w01-lightsans-seriftext-decoration9
16px1 brandon-grot-w01-lightsans-seriftext-decoration comp-jnlht6ba9
normal normal 12px14em9
normal normal 16px19
48 47 06comp-jnlht6ba8
normal normal 14px20px8
normal 14px14em brandon-grot-w01-lightsans-serifcomp-jnlht6ba8
16px15em brandon-grot-w01-lightsans-seriftext-decoration comp-jnlht6ba8
normal 16px15em brandon-grot-w01-lightsans-seriftext-decoration8
normal 12px14em brandon-grot-w01-lightsans-serifcomp-jnlht6ba8
normal 14px20px brandon-grot-w01-lightsans-serifcomp-jnlht6ba8
1background-colorrgba255 255 2558
streetwear clothing store8
aracne co clothing8
shameless fearless reckless8
store shameless fearless8
clothing store shameless8
border-width2px border-stylesolidborder-colorrgba249 2498
249 249 1background-colorrgba2558
249 1background-colorrgba255 2558
border-stylesolidborder-colorrgba249 249 2498
normal normal 15px18px7
normal 15px18px wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtext-decoration7
07border-colorrgba46 48 477
48 47 07comp-jnlht6ba7
12px14em brandon-grot-w01-lightsans-serifcomp-jnlht6ba dropdown2713770132rootdropdown2713770132--mobile7
fontnormal normal normal6
normal 16px14em brandon-grot-w01-lightsans-serif6
normal normal 14px16
normal 14px1 brandon-grot-w01-lightsans-seriftext-decoration6
14px1 brandon-grot-w01-lightsans-seriftext-decoration comp-jnlht6ba6
wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtext-decoration colorrgb217 2165
48 47 07border-colorrgba465
47 07border-colorrgba46 485
background-colorrgba255 255 2555
rgba0 71 1865
helveticaneuew02-55roma helveticaneuew10-55roma helvetica5
16px14em brandon-grot-w01-lightsans-seriftext-decoration comp-jnlht6ba5
10px 10px 10px5
helveticaneuew10-55roma helvetica arial5
neue helveticaneuew01-55roma helveticaneuew02-55roma5
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma5
normal 16px14em brandon-grot-w01-lightsans-seriftext-decoration5
colorpickeritem2561287067radioouterbox-shadow0 0 04
15px18px wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtext-decoration colorrgb2174
216 214backgroundrgb0 714
clothing storetypemetapropsnamedescriptioncontentaracne co4
co clothing storetypemetapropsnamedescriptioncontentaracne4
255 255 07comp-jnlht6ba4
07colorrgba255 255 2554
48 47 042comp-jnlht6ba4
48 47 06border-width1pxcomp-jnlht6ba4
07colorrgba46 48 474
255 07colorrgba46 484
255 255 07colorrgba464
brandon-grot-w01-lightsans-seriftext-decoration comp-jnlht6ba dropdownoption3572813792rootnotdropdownoption3572813792--selectable4
storetypemetapropsnamedescriptioncontentaracne co streetwear4
2s ease-in-outborder-color 2s4
4px 0 rgba00014
0 0 04
0 0 1px4
ease-in-outborder-color 2s ease-in-outcolor4
2s ease-in-outcolor 2s4
1border-width0pxborder-radius10px 10px 10px4
53 1border-width0pxborder-radius10px 10px4
39 53 1border-width0pxborder-radius10px4
border-width2pxborder-colorrgba204 204 2044
255 1 style-jzl0z2mjmenucontainer4
4px 8px 04
0 4px 04
255 1 style-kb1o5vysnavcontainer4
1px rgba46 484
rgba0 0 04
rgba255 255 2554
dropdownoption978924491dropdownoption dropdown2713770132dropdown dropdownbase3644427161rootcomp-jnlht6ba3
positionfixed importantleftauto importantz-index503
0px calc10px 0px3
storepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildren aracne co3
clothing storepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildren aracne3
inputbackgroundffffffcolor2e302ffontnormal normal normal3
normal 16px15em brandon-grot-w01-lightsans-serifcomp-jnlht6ba3
39 53 13
co clothing storepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildren3
mxmetakeywordsseopagetitleseo aracne co3
reckless mxmetakeywordsseopagetitleseo aracne3
fearless reckless mxmetakeywordsseopagetitleseo3
dropdown2713770132dropdown dropdownbase3644427161rootcomp-jnlht6ba dropdownoption978924491dropdownoption3
solid rgba0 713
48 47 13
dropdownbase3644427161rootcomp-jnlht6ba dropdownoption978924491dropdownoption dropdown2713770132dropdown3
dropdownoption978924491dropdownoption dropdown2713770132dropdowndropdown3980268547--content-visible dropdownbase3644427161rootcomp-jnlht6ba3
dropdown2713770132dropdowndropdown3980268547--content-visible dropdownbase3644427161rootcomp-jnlht6ba dropdownoption978924491dropdownoption3
sort770459381sort dropdown2713770132dropdown dropdownbase3644427161rootcomp-jnlht6ba3
dropdown2713770132dropdown dropdownbase3644427161rootcomp-jnlht6ba sort770459381sort3
colorffffffbackground-colorrgba50 50 503
sort770459381sort dropdown2713770132dropdowndropdown3980268547--content-visible dropdownbase3644427161rootcomp-jnlht6ba3
dropdown2713770132dropdowndropdown3980268547--content-visible dropdownbase3644427161rootcomp-jnlht6ba sort770459381sort3
style-jzl0z2mjitem background-colorrgba255 2553
streetwear clothing storehidetitletrueicondescriptionseoaracne3
clothing storehidetitletrueicondescriptionseoaracne co3
storehidetitletrueicondescriptionseoaracne co streetwear3
box-sizingborder-boxborder-top1px solid rgba03
dropdownbase3644427161rootcomp-jnlht6ba sort770459381sort dropdown2713770132dropdown3
popover3126000425popovercontentbackground-colordf3131border1px solid rgba255255255253
margin0 14px 03
cubic-bezier25464594transformscale1 translatey0 translatex03
normal normal 14px143em3
rgba000120 0 4px3
popover3126000425popoverdata-placementtooltip2361669277popoveranimation-entertooltip2361669277popoveranimation-enter-activeopacity1transitiontransform 120ms cubic-bezier25464594applyopacity3
120ms cubic-bezier25464594applyopacity 120ms3
cubic-bezier25464594applyopacity 120ms cubic-bezier25464594transformscale13
120ms cubic-bezier25464594transformscale1 translatey03
popover3126000425popoverdata-placementtooltip2361669277popoveranimation-exitopacity1transformscale1 translatey0 translatex03
14px143em brandon-grot-w01-lightsans-seriftext-decoration comp-jnlht6ba3
71 186border-colorrgb217 2163
popover3126000425popoverdata-placementtooltip2361669277popoveranimation-exittooltip2361669277popoveranimation-exit-activeopacity0transitiontransform 80ms linearapplyopacity3
colorrgb217 216 214backgroundrgb03
80ms linearapplyopacity 80ms3
wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtext-decoration colorrgb0 713
normal 16px20px wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtext-decoration3
normal normal 16px20px3
normal 14px143em brandon-grot-w01-lightsans-seriftext-decoration3
normal normal 14px144em3
linearapplyopacity 80ms linear3
kaku gothic prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow03
popover3126000425popovercontentbackground-color212121padding4px 12pxborder1px 7575753
12pxborder1px 757575 solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica3
757575 solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica neuehelveticaarialmeiryo3
solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica neuehelveticaarialmeiryo pro3
neuehelveticaarialmeiryo pro w3hiragino3
pro w3hiragino kaku3
w3hiragino kaku gothic3
gothic prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow0 4px3
normal 14px144em brandon-grot-w01-lightsans-seriftext-decoration3
prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow0 4px 8px3
8px 0 rgba0001203
0 rgba000120 03
20px15em brandon-grot-w01-lightsans-seriftext-decoration comp-jnlht6ba3
normal 20px15em brandon-grot-w01-lightsans-seriftext-decoration3
normal normal 20px15em3
14px144em brandon-grot-w01-lightsans-seriftext-decoration comp-jnlht6ba3
brandon-grot-w01-lightsans-seriffontnormal normal normal3
normal normal137
48 4768
brandon-grot-w01-lightsans-seriftext-decoration comp-jnlht6ba54
1px 16pxcomp-jnlht6ba36
0 035
255 25530
margin-left calc10022
980px 0522
calc100 980px22
47 06fontnormal16
06fontnormal normal16
normal 16px14em16
normal 14px14em15
0 16pxcomp-jnlht6ba14
255 112
ease 0s12
04s ease12
co streetwear11
font normal11
3x2q 2z3nh11
streetwear clothing11
10px 10px11
39 5311
normal 16px15em11
rgba46 4810
15px14em brandon-grot-w01-lightsans-seriftext-decoration10
normal 15px14em10
dropdownoption978924491dropdownoption dropdown2713770132dropdown10
47 03comp-jnlht6ba10
sort770459381sort dropdown2713770132dropdown10
normal 16px19
16px1 brandon-grot-w01-lightsans-seriftext-decoration9
normal 12px14em9
71 1869
normal 14px20px8
12px14em brandon-grot-w01-lightsans-serifcomp-jnlht6ba8
16px15em brandon-grot-w01-lightsans-seriftext-decoration8
14px14em brandon-grot-w01-lightsans-serifcomp-jnlht6ba8
clothing store8
0 4px8
14px20px brandon-grot-w01-lightsans-serifcomp-jnlht6ba8
1background-colorrgba255 2558
249 1background-colorrgba2558
249 2498
border-stylesolidborder-colorrgba249 2498
border-width2px border-stylesolidborder-colorrgba2498
shameless fearless8
204 2048
216 214comp-jnlht6ba8
store shameless8
fontnormal normal8
co clothing8
aracne co8
47 06comp-jnlht6ba8
fearless reckless8
comp-jnlht6ba dropdownoption3572813792rootnotdropdownoption3572813792--selectable7
15px18px wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtext-decoration7
07border-colorrgba46 487
47 07comp-jnlht6ba7
normal 15px18px7
brandon-grot-w01-lightsans-serifcomp-jnlht6ba dropdown2713770132rootdropdown2713770132--mobile7
dropdown2713770132dropdown dropdown3980268547dropdowncontent7
margin0line-heightnormalletter-spacingnormal txtnew7
padding-top calc1007
0px 16pxcomp-jnlht6ba6
16px14em brandon-grot-w01-lightsans-serif6
translatey0 translatex06
14px1 brandon-grot-w01-lightsans-seriftext-decoration6
normal 14px16
dropdown2713770132dropdowndropdown3980268547--content-visible dropdownbase3644427161rootcomp-jnlht6ba6
0 1px6
4px 06
dropdownbase3644427161rootcomp-jnlht6ba dropdownoption978924491dropdownoption6
14px 06
dropdown2713770132dropdown dropdownbase3644427161rootcomp-jnlht6ba6
dropdownbase3644427161rootcomp-jnlht6ba sort770459381sort6
neue helveticaneuew01-55roma5
colorrgb217 2165
wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtext-decoration colorrgb2175
47 07border-colorrgba465
proxima-n-w01-regsans-serif color2e302f5
1px 1px5
rgba0 715
normal bold5
sort2347269111dropdown dropdown3980268547dropdowncontent5
style-kb1mtp19dropdown style-kb1mtp19dropdownwrapper5
helveticaneuew01-55roma helveticaneuew02-55roma5
helvetica arial5
1 style-jzl0z2mjmenucontainer5
style-kb1mtp19languagebuttonlabelstyle-kb1mtp19languagebuttonhas-text margin05
0 14px5
background-colorrgba255 2555
16px14em brandon-grot-w01-lightsans-seriftext-decoration5
1 style-kb1o5vysnavcontainer5
helveticaneuew10-55roma helvetica5
helveticaneuew02-55roma helveticaneuew10-55roma5
216 2144
colorpickeritem2561287067radioouterbox-shadow0 04
clothing storetypemetapropsnamedescriptioncontentaracne4
sort770459381sort dropdown2713770132dropdowndropdown3980268547--content-visible4
255 07colorrgba464
07colorrgba46 484
dropdown2713770132dropdown dropdownbase3644427161root4
39 53comp-jnlht6ba4
216 214backgroundrgb04
47 06border-width1pxcomp-jnlht6ba4
214backgroundrgb0 714
futura-lt-w01-booksans-seriftext-decoration comp-jnlht6ba4
dropdownoption978924491dropdownoption dropdown2713770132dropdowndropdown3980268547--content-visible4
123 1104
47 042comp-jnlht6ba4
proxima-n-w01-regsans-seriftext-decoration comp-jnlht6ba4
07colorrgba255 2554
255 07comp-jnlht6ba4
opacitymin-width1emmin-height1emline-height1emjustify-contentcenteralign-itemscenterpadding5em 5emmargin25em4
storetypemetapropsnamedescriptioncontentaracne co4
2s ease-in-outcolor4
1border-width0pxborder-radius10px 10px4
solid transparent4
style-jzl0z2mjsubmenu style-jzl0z2mjitem4
0 rgba00014
transparent transparent4
8px 04
53 1border-width0pxborder-radius10px4
4px 8px4
1px rgba464
margin0 4px4
2zthn 3rqkm4
buttonnext868628899contentmargin0 autotext-overflowellipsiswhite-spacenowrapoverflowhidden4
ease-in-outcolor 2s4
25em 04
ease-in-outborder-color 2s4
style-jzl0z2mjitem border-radius04
border-width2pxborder-colorrgba204 2044
2s ease-in-outborder-color4
txtnew ul4
rgba0 04
background-color ffffff4
rgba255 2554
color ffffff4
clothing storepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildren3
storepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildren aracne3
max-width 600px3
selectdata-previewerror style-kb1o5vysnavcontainerarrow3
counter2290669049btn pathfill2e302fcomp-jnlht6ba3
style-kb1o5vysnavcontainerarrow style-kb1o5vysnavcontainersvgcontainer3
4px style-kb1mtp19languagebuttoncenter3
brandon-grot-w01-lightsans-serif color2e302f3
mxmetakeywordsseopagetitleseo aracne3
style-kb1mtp19languagebuttoniconstyle-kb1mtp19languagebuttonhas-icon margin03
margin0 14px3
path fillffffff3
50 503
colorffffffbackground-colorrgba50 503
47 13
inputbackgroundffffffcolor2e302ffontnormal normal3
storehidetitletrueicondescriptionseoaracne co3
solid rgba03
dropdownoption3572813792titlecomp-jnlht6ba dropdownoption978924491dropdownoption3
ol ul3
ultxtnew ol3
style-jzl0z2mjitem background-colorrgba2553
clothing storehidetitletrueicondescriptionseoaracne3
style-jzl0z2mjmenucontainerarrow style-jzl0z2mjmenucontainersvgcontainer3
16px15em brandon-grot-w01-lightsans-serifcomp-jnlht6ba3
selectdata-previewerror style-jzl0z2mjmenucontainerarrow3
importantleftauto importantz-index503
positionfixed importantleftauto3
53 13
reckless mxmetakeywordsseopagetitleseo3
0px calc10px3
box-sizingborder-boxborder-top1px solid3
calc10px 0px3
popover3126000425popoverdata-placementtooltip2361669277popoveranimation-entertooltip2361669277popoveranimation-enter-activeopacity1transitiontransform 120ms3
important 3x2q3
tooltip2361669277tpaarrow pathfilldf31313
normal 16px20px3
tooltip2361669277tpaarrow svgdisplayblock3
popover3126000425popoverdata-placementtop tooltip2361669277tpaarrowbottom0width12pxheight7px3
popover3126000425popoverdata-placementbottom tooltip2361669277tpaarrowtop0width12pxheight7px3
popover3126000425popoverdata-placementleft tooltip2361669277tpaarrowright0width7pxheight12px3
popover3126000425popoverdata-placementright tooltip2361669277tpaarrowleft0width7pxheight12px3
counter2290669049btnbackground0 0padding6pxborder0cursorpointer3
popover3126000425popoverdata-placementbottomtooltip2361669277popoveranimation-enteropacity0transformscale9 translatey-3px3
popover3126000425popoverdata-placementlefttooltip2361669277popoveranimation-enteropacity0transformscale9 translatex10px3
solid rgba255255255253
wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtext-decoration colorrgb03
popover3126000425popovercontentbackground-colordf3131border1px solid3
80ms linear3
linearapplyopacity 80ms3
80ms linearapplyopacity3
popover3126000425popoverdata-placementtooltip2361669277popoveranimation-exittooltip2361669277popoveranimation-exit-activeopacity0transitiontransform 80ms3
popover3126000425popoverdata-placementtooltip2361669277popoveranimation-exitopacity1transformscale1 translatey03
popover3126000425popoverdata-placementrighttooltip2361669277popoveranimation-enteropacity0transformscale9 translatex-10px3
cubic-bezier25464594transformscale1 translatey03
120ms cubic-bezier25464594transformscale13
cubic-bezier25464594applyopacity 120ms3
16px20px wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtext-decoration3
colorrgb0 713
120ms cubic-bezier25464594applyopacity3
neuehelveticaarialmeiryo pro3
20px15em brandon-grot-w01-lightsans-seriftext-decoration3
normal 20px15em3
14px144em brandon-grot-w01-lightsans-seriftext-decoration3
normal 14px144em3
14px143em brandon-grot-w01-lightsans-seriftext-decoration3
normal 14px143em3
popover3126000425popovercontentbackground-color212121padding4px 12pxborder1px3
12pxborder1px 7575753
757575 solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica3
solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica neuehelveticaarialmeiryo3
pro w3hiragino3
brandon-grot-w01-lightsans-seriffontnormal normal3
w3hiragino kaku3
kaku gothic3
gothic prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow03
prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow0 4px3
186border-colorrgb217 2163
71 186border-colorrgb2173
71 186comp-jnlht6ba3
0 rgba0001203
02comp-jnlht6ba devicemobile3
rgba000120 03
popover3126000425popoverdata-placementtoptooltip2361669277popoveranimation-enteropacity0transformscale9 translatey3px3
normal265
0131
168
268
comp-jnlht6ba64
360
1px59
16pxcomp-jnlht6ba56
brandon-grot-w01-lightsans-seriftext-decoration55
background-color38
color36
calc10029
pagination3499236751root28
dropdown2713770132dropdown28
brandon-grot-w01-lightsans-serifcomp-jnlht6ba27
427
pagination1936884330root26
important25
solid25
0522
margin-left22
980px22
dropdownoption978924491dropdownoption20
520
16px20
dropdownnativeselect1597652001erroricon20
dropdownerror2927302832root20
style-jzl0z2mjitem19
10px19
619
co19
clothing19
16px14em18
txtnew18
3x2q17
716
4px16
06fontnormal16
sort770459381sort16
816
tooltip2361669277root16
14px14em15
style-jzl0z2mjsubmenu15
devicemobile15
915
style-jzl0z2mjmenucontainer15
2s14
margin013
transparent13
ease13
2zthn13
quantitycounter1985873316quantitycounterquantitycounter1985873316--customized13
style-kb1o5vysnavcontainer13
0px13
dropdownbase3644427161rootcomp-jnlht6ba12
0s12
07comp-jnlht6ba12
04s12
color2e302f12
dropdown3980268547dropdowncontent12
03comp-jnlht6ba11
style-jzl0z2mjmenucontainerarrow11
dropdown2713770132dropdowndropdown3980268547--content-visible11
quantitycounter1985873316quantitycounter11
font11
style-kb1o5vysnavcontainerarrow11
14px11
displaynone11
positionabsolutetop0right0bottom0left011
1011
2z3nh11
ul11
streetwear11
16px15em11
rgba4610
aracne10
wfont9386637d1a39e07640409d9d171e114bb702d5wf7d1a39e07640409d9d171e114origlabgrotesquemediumtext-decoration10
15px14em10
5px9
rgba09
119
16px19
06comp-jnlht6ba9
wkgi09
12px14em9
border-radius09
border-width2px8
128
opacitymin-width1emmin-height1emline-height1emjustify-contentcenteralign-itemscenterpadding5em8
fearless8
brandon-grot-w01-lightsans-serif8
reckless8
pagination2327321151navbutton8
214comp-jnlht6ba8
dropdown2713770132rootdropdown2713770132--mobile8
border-stylesolidborder-colorrgba2498
3uack8
store8
ffffff8
dropdownoption3572813792rootnotdropdownoption3572813792--selectable8
shameless8
dropdownbase3644427161root8
1background-colorrgba2558
14px20px8
fontnormal8
15px18px7
style-kb1mtp19languagebuttonarrow-icon7
style-kb1mtp19dropdown7
var7
style-kb1mtp19languagebutton7
ol7
counter2290669049root7
linear7
2zthn2yocq7
margin0line-heightnormalletter-spacingnormal7
07border-colorrgba467
padding-top7
120ms6
translatey06
translatex06
80ms6
style-kb1o5vysnavcontainerarrowstyle-kb1o5vysnavcontainerright-direction6
style-kb1o5vysnavcontainerarrowstyle-kb1o5vysnavcontainerleft-direction6
style-kb1o5vysnavcontainerarrowstyle-kb1o5vysnavcontainercenter-direction6
1jm7t6
colorpicker1196641707item6
sort2347269111dropdown6
selectdata-previewerror6
tooltip2361669277tpaarrow6
style-kb1mtp19dropdownwrapper6
graphic6
style-jzl0z2mjmenucontainerarrowstyle-jzl0z2mjmenucontainerleft-direction6
selecthover6
selectfocus6
selectdata-previewfocus6
selectdata-errortrue6
style-jzl0z2mjmenucontainerarrowstyle-jzl0z2mjmenucontainerright-direction6
style-jzl0z2mjmenucontainerarrowstyle-jzl0z2mjmenucontainercenter-direction6
14px16
style-kb1mtp19horizontal6
selectdata-previewhover6
padding06
style-kb1mtp19languagebuttonlabelstyle-kb1mtp19languagebuttonhas-text6
0005
background-colorrgba2555
if5
arial5
8px5
helvetica5
helveticaneuew02-55roma5
helveticaneuew10-55roma5
helveticaneuew01-55roma5
pagination1936884330rootpagination1936884330--rtl5
neue5
ultxtnew5
proxima-n-w01-regsans-serif5
bold5
135
select5
style-kb1mtp19languagebuttonright5
3-5se5
calc10px5
colorrgb2175
auto5
style-kb1mtp19languagebuttonleft5
20px5
145
pagination3499236751rootpagination1936884330--rtl5
pagination2327321151navbuttonpagination2327321151--disabled4
n4
storetypemetapropsnamedescriptioncontentaracne4
7px4
53comp-jnlht6ba4
154
07colorrgba2554
5emmargin25em4
coloroption2215770673coloroption4
dropdown2713770132dropdownoption4
042comp-jnlht6ba4
colorpickeritem2561287067radiooutercomp-jnlht6ba4
164
pagination2327321151slash4
futura-lt-w01-booksans-seriftext-decoration4
214backgroundrgb04
07colorrgba464
06border-width1pxcomp-jnlht6ba4
proxima-n-w01-regsans-seriftext-decoration4
colorpickeritem2561287067radioouterbox-shadow04
rgba00014
24px133em4
25em4
style-kb1rljallabel4
border-width2pxborder-colorrgba2044
wfont938663868d996c1a9240ddaca30003fb0312ccwf868d996c1a9240ddaca30003forigtsblockbold4
1bordersolid4
ease-in-outborder-color4
path4
style-jzl0z2mjitemhoverarealast-child4
style-jzl0z2mjlabel4
style-kb1mtp19languagebuttonlast-child4
style-kb1ewpczlink4
1border-width0pxborder-radius10px4
positionabsolutetop0left0color373737width100height1004
3rqkm4
buttonnext868628899contentoverflowvisibletext-overflowunsetwhite-spaceunset4
autotext-overflowellipsiswhite-spacenowrapoverflowhidden4
buttonnext868628899contentmargin04
style-kb1ewpczlabel4
ease-in-outcolor4
style-kb1ewpczlabelwrapper4
b0b0b04
style-kb1o5vysrepeaterbuttonlabel4
style-kb1mtp19languagebuttoniconstyle-kb1mtp19languagebuttonhas-icon4
rgba2554
style-kb1mtp19languagebuttoncenter4
style-kb1rljallabelwrapper4
style-kb1rljallink4
box-sizingborder-box4
fff4
174
overflowhidden3
20px15em3
14px144em3
colorrgb03
14px143em3
style-kb1mtp19currentlanguage3
style-kb1o5vysnavcontainersvgcontainer3
style-kb1mtp19languagebuttonspacer3
brandon-grot-w01-lightsans-seriffontnormal3
style-kb1mtp19mobilelanguageselector3
style-kb1mtp19languagebuttonicon3
style-kb1mtp19languagebuttoncenterstyle-kb1mtp19languagebuttonhorizontal3
colorffffffbackground-colorrgba503
fillffffff3
186border-colorrgb2173
02comp-jnlht6ba3
186comp-jnlht6ba3
style-jzl0z2mjmenucontainerright-direction3
content3
dropdownoption3572813792titlecomp-jnlht6ba3
al3
183
new3
storepageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpkaugjk2obgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1dmpmobilemediarefmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitlesqzzinemockupfreejpguri938663eb61c306486f40c9b257fe60c2d927camv2jpgdescriptionprivatewidth2000height1500altartistidnamecolor222222aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-kb1y8cklmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri9386635d526a7342e24c32b8ecc29c11716b3dmv2jpgwidth2480height3508altadvancedseodatatagstypetitlechildren3
mxmetakeywordsseopagetitleseo3
positionfixed3
importantleftauto3
storehidetitletrueicondescriptionseoaracne3
importantz-index503
topautobottom03
093
oldirrtl3
box-sizingborder-boxborder-top1px3
style-jzl0z2mjmenucontainercenter-direction3
style-jzl0z2mjitemhoverareafirst-child3
inputbackgroundffffffcolor2e302ffontnormal3
counter2290669049btndisabled3
pathfill2e302fcomp-jnlht6ba3
counter2290669049btn3
border-bottom-left-radius0border-bottom-right-radius03
style-jzl0z2mjsubmenubefore3
style-jzl0z2mjmenucontainersvgcontainer3
svg3
style-jzl0z2mjmenucontainerleft-direction3
border-left03
style-kb1o5vysnavcontainerleft-direction3
border-right03
16px20px3
kaku3
style-kb1o5vysnavcontainerright-direction3
tooltip2361669277tpaarrowright0width7pxheight12px3
cubic-bezier25464594transformscale13
cubic-bezier25464594applyopacity3
neuehelveticaarialmeiryo3
popover3126000425popoverdata-placementtooltip2361669277popoveranimation-entertooltip2361669277popoveranimation-enter-activeopacity1transitiontransform3
translatex-10px3
popover3126000425popoverdata-placementrighttooltip2361669277popoveranimation-enteropacity0transformscale93
translatex10px3
popover3126000425popoverdata-placementlefttooltip2361669277popoveranimation-enteropacity0transformscale93
translatey-3px3
popover3126000425popoverdata-placementbottomtooltip2361669277popoveranimation-enteropacity0transformscale93
translatey3px3
popover3126000425popoverdata-placementtoptooltip2361669277popoveranimation-enteropacity0transformscale93
tooltip2361669277tpaarrowleft0width7pxheight12px3
popover3126000425popoverdata-placementright3
popover3126000425popoverdata-placementleft3
193
tooltip2361669277tpaarrowtop0width12pxheight7px3
popover3126000425popoverdata-placementbottom3
tooltip2361669277tpaarrowbottom0width12pxheight7px3
popover3126000425popoverdata-placementtop3
popover3126000425popoverdata-placementrighttooltip2361669277witharrowpadding-left6px3
popover3126000425popoverdata-placementlefttooltip2361669277witharrowpadding-right6px3
popover3126000425popoverdata-placementbottomtooltip2361669277witharrowpadding-top6px3
popover3126000425popoverdata-placementtoptooltip2361669277witharrowpadding-bottom6px3
svgdisplayblock3
pro3
tooltip2361669277tpaarrowdisplayblockpositionabsolutemargin03
w3hiragino3
rgba0001203
prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow03
solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica3
popover3126000425popoverdata-placementtooltip2361669277popoveranimation-exitopacity1transformscale13
style-kb1o5vysnavcontainercenter-direction3
0padding6pxborder0cursorpointer3
gothic3
world3
2boaq10zvw3
max-width3
600px3
input-ms-cleardisplaynone3
inputtypenumber-moz-appearancetextfield3
input-webkit-inner-spin-button-webkit-appearancenonemargin03
input-webkit-outer-spin-button3
inputpadding0border0text-aligncenterwidth1003
counter2290669049inputwrapperflex13
2zthn2ahc63
svgcolordf31313
counter2290669049btndisabledcursordefault3
counter2290669049btnbackground03
popover3126000425popoverdata-placementtooltip2361669277popoveranimation-exittooltip2361669277popoveranimation-exit-activeopacity0transitiontransform3
3sc7knotonly-of-typefirst-of-type3
3sc7knotonly-of-typelast-of-type3
12px3
3ds0z3
dropdownbase3644427161rootbutton2197027860--upgrade3
2n0k3
1hm3padding03
popover3126000425arrowborder-width5px3
popover3126000425popovercontentbackground-color212121padding4px3
pathfilldf31313
rgba255255255253
popover3126000425popovercontentbackground-colordf3131border1px3
linearapplyopacity3
12pxborder1px3
tu3

Who hosts Aracne.shop?

Aracne.shop Hosting Provider Information

Hosted IP Address:185.230.63.171
Hosted Hostname:185.230.63.171
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:United StatesUS
Location Latitude:39.018
Location Longitude:-77.539
Webserver Software:Pepyaka/1.19.0

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%

HTTP Header Analysis for Aracne.shop

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 17 Apr 2021 13:36:04 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1618666563.9991008147382116529
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
strict-transport-security: max-age=120
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVhP3UVzDz9CrWcUvFvX3Kki,qquldgcFrj2n046g4RNSVO38E53VHF73OUfaaLx5QS1YgeUJqUXtid 86vZww nL,2d58ifebGbosy5xc FRalt8uc90TqQ/UbppSJSS40UPhFsHSZ yo3r59Fj8njRGbGgqFbFMYwiXnFojPwdof6MPDJ/7kGADWVVaMywKi2q4=,2UNV7KOq4oGjA5 PKsX47NdwL56oCSUGh LISE2KX3A=,LXlT8qjS5x6WBejJA3 gBSfeheh57 fnur/FSQXBlFiTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,jmlhAcZUgDXxQVz2aYgmJHVFgjLZOYzeuHficaomZNkWch/S6jj PxLBKrNbj68Iiy9RDN50yNDYuMRjpFglRg==,LXlT8qjS5x6WBejJA3 gBSfeheh57 fnur/FSQXBlFiTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,Ts 7R/4FijtA6c9psi3FQAttO6OVl9fyMrFanfwvqaqTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LoUK8/saGAmOxZWtpubo2rV6V640/TFv9nWANtlB5ofUwsr9v4GVF95yGE73zeu1uGeEfXVWSmjVKbVoF1f/9A==,Ts 7R/4FijtA6c9psi3FQAttO6OVl9fyMrFanfwvqaqTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHGEWYDIFnPDYvZF H7iQwDXb8hsQcSFMZvyw3V kcLJ7BDZE6kdUg7NZxz5/mgXht8=,IaDuTAMGGvhXtruM6nHg6mZDSpRGFXLWKPmpDzjzFFOTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,IaDuTAMGGvhXtruM6nHg6vmS2iCiVZY4TY3Ofykqcb2TzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,CU5GbgCT5nWPaA3tUS4mLDJ57HN4rKLyBiFEW4Gh4LjQLtyCt8AySUsBjfEadbC/R bN64IltT hlUo4iugV3w==
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
cache-control: private,max-age=0,must-revalidate
X-Content-Type-Options: nosniff
Content-Encoding: gzip
Server: Pepyaka/1.19.0

Aracne.shop Domain Nameserver Information

HostIP AddressCountry
ns1.wixdns.net 216.239.34.101
ns0.wixdns.net 216.239.32.101


Need to find out who hosts Aracne.shop?


Domain Registration (WhoIs) information for Aracne.shop

 Domain Name: ARACNE.SHOP
Registry Domain ID: DO4945966-GMO
Registrar WHOIS Server:
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-07-31T05:14:56.0Z
Creation Date: 2020-05-27T03:14:35.0Z
Registry Expiry Date: 2021-05-27T23:59:59.0Z
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant State/Province: MX-CHH
Registrant Country: MX
Registrant Email:
Admin Email:
Tech Email:
Name Server: NS0.WIXDNS.NET
Name Server: NS1.WIXDNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-04-17T13:36:06.0Z

Websites with Similar Names

Aracnakliyem.online
aracnakliyem.online Premium Park Sayfası
Aracnation.com
Aracnation
Aracnc.com
Apache HTTP Server Test Page powered by CentOS
Aracne.com
Pagina di Redirect
Aracne.name
aracne.name
Aracne.shop
ARACNE Co | Clothing Store
Aracneabbigliamento.shop
aracneabbigliamento.shop -&nbsparacneabbigliamento Resources and Information.

Recently Updated Websites

Yaqivip349.app (5 seconds ago.)Tierarzt-rw.de (11 seconds ago.)Williamsnutriton.com (12 seconds ago.)Egao-ikigai.org (12 seconds ago.)Entolabs.in (12 seconds ago.)Drstarica.com (14 seconds ago.)Militaryblog.jp (18 seconds ago.)Designerdeerfarms.com (18 seconds ago.)Thecrochetcrowd.com (20 seconds ago.)Plantsjoy.com (21 seconds ago.)Avdh01.cc (24 seconds ago.)G7n.net (27 seconds ago.)Ferrarifoodtour.com (28 seconds ago.)Respublica-news.az (29 seconds ago.)Remi-m.fr (29 seconds ago.)Thefoundationbuddies.com (31 seconds ago.)Healthy-street.co.uk (32 seconds ago.)En.novayagazeta.ru (33 seconds ago.)Ftiprojects.com (37 seconds ago.)Oskcartonmachines.com (37 seconds ago.)Sxxgps.com (38 seconds ago.)Allthingsberlin.com (39 seconds ago.)Ieltsfever.org (40 seconds ago.)Nhif.gov.sd (42 seconds ago.)Vitma-s.ru (43 seconds ago.)Mobilpedi.com (46 seconds ago.)Thepavarotti.com (46 seconds ago.)Kyxt.cc (47 seconds ago.)Oceandecade-conference.com (48 seconds ago.)Memoriesofmaine.com (50 seconds ago.)

Recently Searched Keywords

6 dic 2020 (1 second ago.)sim4ple (1 second ago.)31 10 70 (2 seconds ago.)nhm cho (2 seconds ago.)notre site web (2 seconds ago.)support and contact (2 seconds ago.)26 100 (3 seconds ago.)f8ece6 display (3 seconds ago.)26 100 (3 seconds ago.)身体护理 (3 seconds ago.)annuel labellise st0fill6a6f6a (3 seconds ago.)nhn channel (3 seconds ago.)18 ago 2019 (4 seconds ago.)citizens united decision quizlet (4 seconds ago.)pants on fire cast (4 seconds ago.)get_space_allowed (4 seconds ago.)continua come (5 seconds ago.)quality www.fabriccable.net quality certificates (5 seconds ago.)nhn chemical (5 seconds ago.)pasticceria giubiasco (5 seconds ago.)655 91 (6 seconds ago.)coin des organisateurs (6 seconds ago.)fetedelanature 2020 (6 seconds ago.)787 (6 seconds ago.)panetteria pasticceria (7 seconds ago.)vedio (7 seconds ago.)marketing strategy template (7 seconds ago.)262 655 91 (8 seconds ago.)adminuser 0 (8 seconds ago.)continua come e (8 seconds ago.)