Architecturalgeometry.org Favicon Architecturalgeometry.org

Architecturalgeometry.org Website Thumbnail
Checking...
Architectural Geometry - Architekturgeometrie
Low trust score
Add a review Change category Claim this site
Architectural Geometry


Domain summary

Domain label
architecturalgeometry
Domain extension
org
Domain registered:
2014-10-01
Domain updated:
2020-10-17
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is architecturalgeometry.org ranked relative to other sites:

Percentage of visits to architecturalgeometry.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Architecturalgeometry.org registered?
A: Architecturalgeometry.org was registered 6 years, 3 weeks, 1 day, 2 hours, 33 minutes, 41 seconds ago on Wednesday, October 1, 2014.
Q: When was the WHOIS for Architecturalgeometry.org last updated?
A: The WHOIS entry was last updated 6 days, 2 hours, 33 minutes, 41 seconds ago on Saturday, October 17, 2020.
Q: What are Architecturalgeometry.org's nameservers?
A: DNS for Architecturalgeometry.org is provided by the following nameservers:
  • ns32.domaincontrol.com
  • ns31.domaincontrol.com
Q: Who is the registrar for the Architecturalgeometry.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Architecturalgeometry.org?
A: Architecturalgeometry.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Architecturalgeometry.org each day?
A: Architecturalgeometry.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Architecturalgeometry.org resolve to?
A: Architecturalgeometry.org resolves to the IPv4 address 46.252.18.132.
Q: In what country are Architecturalgeometry.org servers located in?
A: Architecturalgeometry.org has servers located in the Germany.
Q: What webserver software does Architecturalgeometry.org use?
A: Architecturalgeometry.org is powered by Apache webserver.
Q: Who hosts Architecturalgeometry.org?
A: Architecturalgeometry.org is hosted by domainfactory GmbH in North Rhine-westphalia, Germany.
Q: How much is Architecturalgeometry.org worth?
A: Architecturalgeometry.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Architecturalgeometry.org?

Architecturalgeometry.org Hosting Provider Information

Hosted IP Address:46.252.18.132
Hosted Hostname:barduk.ispgateway.de
Service Provider:domainfactory GmbH
Hosted Country:GermanyDE
Location Latitude:51.4476
Location Longitude:7.0122
Webserver Software:Apache

Is "domainfactory GmbH" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Architecturalgeometry.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 17 Oct 2020 18:24:04 GMT
Server: Apache
Upgrade: h2c
Connection: Upgrade
Last-Modified: Thu, 10 Oct 2019 08:48:38 GMT
ETag: "328b-5948a77bb6495"
Accept-Ranges: bytes
Content-Length: 12939
Content-Type: text/html

Architecturalgeometry.org Domain Nameserver Information

HostIP AddressCountry
ns32.domaincontrol.com 173.201.73.16
ns31.domaincontrol.com 97.74.105.16


Need to find out who hosts Architecturalgeometry.org?


WhoIs information for Architecturalgeometry.org

 Domain Name: ARCHITECTURALGEOMETRY.ORG
Registry Domain ID: D170631419-LROR
Registrar WHOIS Server: whois.meshdigital.com
Registrar URL: https://www.domainbox.com
Updated Date: 2020-05-14T19:27:01Z
Creation Date: 2014-01-10T15:26:49Z
Registry Expiry Date: 2021-01-10T15:26:49Z
Registrar Registration Expiration Date:
Registrar: Mesh Digital Limited
Registrar IANA ID: 1390
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +44.1483304030
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization:
Registrant State/Province:
Registrant Country: AT
Name Server: NS.NAMESPACE4YOU.DE
Name Server: NS2.NAMESPACE4YOU.DE
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-18T06:12:16Z

Architecturalgeometry.org Free SEO Report

Website Inpage Analysis for Architecturalgeometry.org

H1 Headings

1 :
  1. Architectural Geometry - Architekturgeometrie

H2 Headings

9 :
  1. About the AAG conferences
  2. About the books
  3. How to order the book
  4. Architekturgeometrie
  5. Inhalt
  6. Architectural Geometry
  7. Content
  8. Reviews of Architectural Geometry
  9. Errata

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

5:
  1. 2018 AAG conference in Gothenburg
    http://www.architecturalgeometry.org/aag18
  2. Pdf
    http://architecturalgeometry.org/review-fulltext-1.pdf
  3. Pdf
    http://architecturalgeometry.org/swissgeometry.pdf
  4. Pdf
    http://architecturalgeometry.org/review_husty_ibdg.pdf
  5. errata
    http://architecturalgeometry.org/errata.html

Links - Internal (nofollow)

0:

Links - Outbound

9:
  1. 2020 AAG conference in Paris
    http://www.aag2020.com
  2. Springer website
    http://www.springer.com/springerwiennewyork/architecture/book/978-3-211-99765-9
  3. Amazon.de
    http://www.amazon.de/Architekturgeometrie-Helmut-Pottmann/dp/3211997652/ref=sr_1_1?ie=UTF8&s=books&qid=1265830859&sr=8-1
  4. Bentley Institute Press website
    http://www.bentley.com/en-GB/Training/Books/Architectural+Geometry.htm
  5. Amazon.com
    http://www.amazon.com/gp/product/193449304X/103-2668819-9693439
  6. www.lmz.at
    http://www.lmz.at
  7. Architekturgeometrie
    http://www.architecturalgeometry.at
  8. Architectural Geometry
    http://www.architecturalgeometry.at
  9. GMIG
    http://www.geometrie.tuwien.ac.at/ig/

Links - Outbound (nofollow)

0:

Keyword Cloud for Architecturalgeometry.org

bentley institute pressalsarchitectsbookaagoptimizationarchitecture1pdfpublishednotstudentsconstructionversionschoolmodelingpresstopicsvonarchitekturgeometriedergeometrieonlineuniversitycurvesaag conferencebentley institutebentleyfreeformorderaucharchitecturalarchitekturinstitute presszu0geometryarchitectural geometryapplicationdesnewgeometricdigitalallitsresearchshapedesignersfrshapesistsurfacesmayspringergermanwerdenconferencedieder architekturindustrialinstitutedesign

Longtail Keyword Density for Architecturalgeometry.org

KeywordsOccurences
bentley institute press5
architectural geometry12
aag conference5
bentley institute5
institute press5
der architektur3
geometry24
architectural17
der10
book9
fr9
architecture9
design8
architekturgeometrie7
von6
als6
die6
aag6
university6
surfaces5
architektur5
press5
institute5
bentley5
ist5
conference5
modeling4
geometric4
digital4
not4
freeform4
its4
zu4
version4
topics3
school3
pdf3
published3
shape3
designers3
architects3
optimization3
03
german3
curves3
springer3
13
geometrie3
order3
all3
industrial3
students3
research3
application3
may3
new3
shapes3
construction3
online3
werden3
des3
auch3

Architecturalgeometry.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Architecturalgeometry.org is a scam?

Websites with Similar Names

Archi-and.com
Home | and-i
Archi-archi21.xyz
Welcome to archi-archi21.xyz
Archi-archi23.xyz
Best Books Library
Archi-archi8.xyz
Best Books Library
Archi-art.net
THE PORTAL RESOURCES IN ARCHITECTURE AND ART – A good balance of historical and contemporary works
Archi-assistance.com
Archi' Assistance, site en construction
Archi-book.com
アーキブック|建築・建設業の課題を専門家へ無料相談 工事発注の流れをスムーズに!
Archi-cake-ture.com
ARCHI-CAKE-TURE

Recently Updated Websites

Tavansanat.com 2 seconds ago.Anglicanman.com 2 seconds ago.Heavenonearthlifestyle.com 2 seconds ago.Theanimatedadvisor.com 2 seconds ago.Pinklemonaidstand.org 2 seconds ago.Mycanvasisagallery.com 3 seconds ago.Quidelspgnews.com 4 seconds ago.Dellscomedyclub.com 4 seconds ago.Togoportail.net 4 seconds ago.298288.com 4 seconds ago.Todostep.ru 4 seconds ago.Fieldtripwny.com 5 seconds ago.Tarotgram.mobi 6 seconds ago.Rfusinato.com 6 seconds ago.Northeystreethouse.com 6 seconds ago.Bankerpreneur.net 7 seconds ago.Znamenitosti.in 7 seconds ago.Luqueymerino.com 7 seconds ago.Philippibaptistchurch.com 7 seconds ago.Belt-wrestling.ru 7 seconds ago.Photowebeu.com 7 seconds ago.Bridgemailsystem.com 8 seconds ago.Morganemeheut.com 9 seconds ago.Piedmont-tree.com 9 seconds ago.Provparksconservancy.org 9 seconds ago.Meircconference.com 9 seconds ago.Manufacturingskillsinstitute.org 9 seconds ago.Hudclosing.net 10 seconds ago.Zeugnisanalyse.com 10 seconds ago.Stlprosbaseball.com 10 seconds ago.