Modern Solid Wood Furniture Inspired by Nature – Artemano

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: Shopping

Artemano specializes in modern solid wood furniture & home decor. Our creations share the beauty of handcrafted wood furniture & convey our love of wood.



Domain summary

Last updated
2021-03-22
Domain label
artemano
Domain extension
ca
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Artemano.ca registered?
A: Artemano.ca was registered 6 months, 6 days, 7 hours, 26 minutes, 22 seconds ago on Monday, March 22, 2021.
Q: When was the WHOIS for Artemano.ca last updated?
A: The WHOIS entry was last updated 6 months, 6 days, 7 hours, 26 minutes, 22 seconds ago on Monday, March 22, 2021.
Q: What are Artemano.ca's nameservers?
A: DNS for Artemano.ca is provided by the following nameservers:
  • kristin.ns.cloudflare.com
  • lynn.ns.cloudflare.com
Q: Who is the registrar for the Artemano.ca domain?
A: The domain has been registered at CIRA.
Q: What is the traffic rank for Artemano.ca?
A: Artemano.ca has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Artemano.ca each day?
A: Artemano.ca receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Artemano.ca resolve to?
A: Artemano.ca resolves to the IPv4 address 23.227.38.32.
Q: In what country are Artemano.ca servers located in?
A: Artemano.ca has servers located in the Canada.
Q: What webserver software does Artemano.ca use?
A: Artemano.ca is powered by CloudFlare webserver.
Q: Who hosts Artemano.ca?
A: Artemano.ca is hosted by Shopify, Inc. in Canada.
Q: How much is Artemano.ca worth?
A: Artemano.ca has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Artemano.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Artemano.ca Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Artemano.ca

H1 Headings

0 :

H2 Headings

2 :
  1. FR
  2. FR

H3 Headings

1 :
  1. LIVRAISON GRATUITE - FREE DELIVERY

H4 Headings

5 :
  1. LIVRAISON GRATUITE POUR VOS ACHATS EN LIGNE
  2. TOUTES NOS COLLECTIONS - 15%
  3. Notre Application est PRÊTE
  4. ENSEMBLES DE SALON - 25%
  5. COLLECTION SPRING - 20% SUR VOS ACHATS EN LIGNE

H5 Headings

3 :
  1. RESTEZ EN CONTACT AVEC NOUS - - - - - - - - - - - - - - - - - - - - STAY IN TOUCH WITH OUR STORIE
  2. Language
  3. Payment

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

16 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-40861724-1

Links - Internal

46:

Links - Internal (nofollow)

0:

Keyword Cloud for Artemano.ca

may applypourupsdecorationunfree deliveryfalsefranaislampsapplyconsoles cabinetssidetrueconsolesnosofficeswymhostedpluginswymreadyroomdininglongueuil7hswymnotepadkmbookcasesdeliverytime03sour3returnswappnamedategettimegoogletablesstoremaybrossard1nullscriptconditions may applyswympluginswymreadyenglishstores03s visibility 03msswymoverlayottawabookcases consolesevisibility 03mspick2onlinewishlistsifdining room0winboomrlswympluginnous4visibilityelse ifconditions may03mselsecartopacity 03scabinetspurchasedesnoneenglish franaispick upschairsfunction50 kmcontactnewconditionsvarnew dategettimeleslignelivingtables bookcasesopacitylanguage03s visibilityopacity 03s visibilityaveclivraisonswymnotificationbedroomswymhostedpluginetfreexliving room

Longtail Keyword Density for Artemano.ca

KeywordsOccurences
- - -8
opacity 03s visibility5
03s visibility 03ms5
conditions may apply3
- -9
visibility 03ms5
free delivery5
03s visibility5
opacity 03s5
bookcases consoles4
50 km4
consoles cabinets4
new dategettime4
tables bookcases4
living room4
english franais3
pick ups3
dining room3
may apply3
conditions may3
else if3
var24
function14
if12
03ms10
false10
-10
none9
longueuil8
cabinets8
bookcases8
tables8
room7
pour7
else7
delivery7
consoles6
visibility6
conditions6
06
our6
stores5
les5
swym-notepad5
english5
free5
opacity5
03s5
swym-hosted-plugin4
swym-overlay4
swym-plugin4
14
script4
new4
7h4
swym-notification4
un4
nos4
km4
24
dategettime4
online4
et4
cart4
chairs4
living4
side4
brossard4
wishlist4
lamps4
des3
return3
may3
apply3
swym-hosted-pluginswym-ready3
swym-pluginswym-ready3
dining3
language3
null3
true3
livraison3
contact3
bedroom3
swappname3
x3
s3
office3
purchase3
decoration3
ups3
pick3
franais3
nous3
33
store3
avec3
google3
time3
e3
ottawa3
ligne3
43
winboomrl3

Who hosts Artemano.ca?

Artemano.ca Hosting Provider Information

Hosted IP Address:23.227.38.32
Hosted Hostname:23.227.38.32
Service Provider:Shopify, Inc.
Hosted Country:CanadaCA
Location Latitude:43.6319
Location Longitude:-79.3716
Webserver Software:CloudFlare

Is "Shopify, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Shopify, Inc.
0.9667%

HTTP Header Analysis for Artemano.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 22 Mar 2021 21:35:59 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Sorting-Hat-PodId: 194
X-Sorting-Hat-ShopId: 3992191074
X-Storefront-Renderer-Rendered: 1
ETag: cacheable:ddf957adb8a19f365184f19b6b8eed2c
X-Alternate-Cache-Key: cacheable:b83d8ab97c3011d0aa0c0b69f10225f8
Content-Encoding: gzip
X-Cache: miss
X-Frame-Options: DENY
Content-Security-Policy: block-all-mixed-content; frame-ancestors 'none'; upgrade-insecure-requests;
Strict-Transport-Security: max-age=7889238
X-ShopId: 3992191074
X-ShardId: 194
Vary: Accept
Content-Language: en
X-Shopify-Stage: production
X-Dc: gcp-us-central1,gcp-us-central1,gcp-us-central1
X-Request-ID: 45780111-e0ba-4a44-a813-400376e64d6e
X-Download-Options: noopen
X-Permitted-Cross-Domain-Policies: none
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
NEL: {"report_to":"network-errors","max_age":2592000,"success_fraction":0.0001}
Report-To: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifycloud.com/v1/reports/nel/20190325/shopify"}]}
CF-Cache-Status: DYNAMIC
cf-request-id: 08fd76cba30000072251a3c000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 63428d8c38940722-LHR
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Artemano.ca Domain Nameserver Information

HostIP AddressCountry
kristin.ns.cloudflare.com 172.64.32.181
lynn.ns.cloudflare.com 108.162.193.201


Need to find out who hosts Artemano.ca?


Domain Registration (WhoIs) information for Artemano.ca

 Domain Name: artemano.ca
Registry Domain ID: D155936-CIRA
Registrar WHOIS Server: whois.ca.fury.ca
Registrar URL: http://domainhelp.tucows.com
Updated Date: 2020-05-07T18:14:15Z
Creation Date: 2003-04-04T14:17:02Z
Registry Expiry Date: 2026-04-04T04:00:00Z
Registrar: Tucows.com Co.
Registrar IANA ID: not applicable
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: 70553978-CIRA
Registrant Name: Rodi Design Inc
Registrant Organization:
Registrant Street: 1100 boul Marie-Victorin
Registrant City: Longueuil
Registrant State/Province: QC
Registrant Postal Code: J4G2H9
Registrant Country: CA
Registrant Phone: +1.4506797755
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: 81781235-CIRA
Admin Name: Bruno Rodi
Admin Organization: Rodi Design Inc
Admin Street: 1100 boul Marie-Victorin
Admin City: Longueuil
Admin State/Province: QC
Admin Postal Code: J4G2H9
Admin Country: CA
Admin Phone: +1.4506797755
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: 81781236-CIRA
Tech Name: Igor Artemov
Tech Organization: Rodi Design Inc
Tech Street: 1100 boul Marie-Victorin
Tech City: Longueuil
Tech State/Province: QC
Tech Postal Code: J4G2H9
Tech Country: CA
Tech Phone: +1.4506797755
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Billing ID:
Billing Name:
Billing Organization:
Billing Street:
Billing City:
Billing State/Province:
Billing Postal Code:
Billing Country:
Billing Phone:
Billing Phone Ext:
Billing Fax:
Billing Fax Ext:
Billing Email:
Name Server: kristin.ns.cloudflare.com
Name Server: lynn.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-03-22T21:35:59Z

Websites with Similar Names

Artem-alagizov.com
artem alagizov
Artem-anna-wedding.ru
???????????? ??????? ?? ????????
Artem-anna.com
ПРИГЛАСИТЕЛЬНОЕ
Artem-avtodiz.ru
??? «???????»
Artem-bilenko.com
Life Line Energy
Artem-catv.ru
АльянсТелеком
Artem-conseil.com
ARTEM Conseil : cabinet de recrutement - chasseur de talents

Recently Updated Websites

Rynekbitcoin.pl (3 minutes 40 seconds ago.)Schomeloan.com (6 minutes 12 seconds ago.)Tagracademy.com (6 minutes 13 seconds ago.)Mehrazco.com (6 minutes 14 seconds ago.)Livingclassrooms.info (6 minutes 20 seconds ago.)Giatreotv.com (6 minutes 22 seconds ago.)Internetpormeses.net (6 minutes 23 seconds ago.)Lesdelices86.com (6 minutes 23 seconds ago.)Wowmindset.com (6 minutes 25 seconds ago.)Jakes-customs.com (6 minutes 29 seconds ago.)Qicaiprinting.com (6 minutes 40 seconds ago.)Appmake.com.br (6 minutes 41 seconds ago.)Dxbee.ae (6 minutes 42 seconds ago.)Wissensbuch.com (6 minutes 46 seconds ago.)Communityagain.com (6 minutes 47 seconds ago.)Rockhillrealtor.com (6 minutes 50 seconds ago.)Insurancecomacon.com (6 minutes 53 seconds ago.)Appdinamico3.com (6 minutes 53 seconds ago.)919100.top (6 minutes 55 seconds ago.)Fastandfabulousgames.com (6 minutes 58 seconds ago.)Spotlessautolaundries.com (6 minutes 58 seconds ago.)Locksmith-ct-hartford.com (7 minutes 5 seconds ago.)Rcoservicesllc.com (7 minutes 7 seconds ago.)Duquesalba.com (7 minutes 8 seconds ago.)Colonymiami.com (7 minutes 10 seconds ago.)Conarycleaningservices.com (7 minutes 12 seconds ago.)Frydensbjerg-iversen.dk (7 minutes 14 seconds ago.)Cbdbananabread.com (7 minutes 22 seconds ago.)Atolyenotlari.com (7 minutes 23 seconds ago.)Improvingpdhpe.com (7 minutes 23 seconds ago.)

Recently Searched Keywords

17 jun (1 second ago.)nexxt router login (1 second ago.)careermatch (1 second ago.)schma (2 seconds ago.)west melton real estate (2 seconds ago.)justin earle youtube (3 seconds ago.)搜房网 (3 seconds ago.)legends bang bang (3 seconds ago.)free on amazon kindle (4 seconds ago.)podcast blog (5 seconds ago.)buy now » (6 seconds ago.)font-family sacramento (6 seconds ago.)8 days a week chords (8 seconds ago.)book summary (9 seconds ago.)privacy policy online (9 seconds ago.)bvlgari yacht club (10 seconds ago.)kanmeiju (12 seconds ago.)fr sex (13 seconds ago.)justineearly (14 seconds ago.)fc-paginationdivactive page-number formcraft-css (14 seconds ago.)nulledpremium (15 seconds ago.)http documentwriteunescape3cscript (15 seconds ago.)handmade soaps (16 seconds ago.)duo access edition (17 seconds ago.)abdallah rothman (18 seconds ago.)grand prix (18 seconds ago.)dental office software (20 seconds ago.)post tdquotebox (20 seconds ago.)100 background -webkit-linear-gradienttop (21 seconds ago.)acomp-kbpl4spu pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles (21 seconds ago.)