Artikel-fakten.de  |  Page Restrictor Ping
Low trust score  | 

Artikel-fakten.de Website Information

Artikel-fakten.de has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 8,912,623, a Majestic Rank of 0, a Domain Authority of 28% and is not listed in DMOZ.

Artikel-fakten.de is hosted by Hetzner Online GmbH in Germany.
Artikel-fakten.de has an IP Address of 188.40.47.211 and a hostname of srv01.platinpower.com and runs Apache/2.2.16 (Debian) web server.

The domain artikel-fakten.de was registered 201 decades 8 years 9 months ago by , it was last modified 5 years 6 months 5 days ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for artikel-fakten.de

Full Whois Lookup for Artikel-fakten.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: artikel-fakten.de
Nserver: ns.inwx.de
Nserver: ns2.inwx.de
Nserver: ns3.inwx.de
Status: connect
Changed: 2014-01-06T17:53:18+01:00

[Tech-C]
Type: PERSON
Name: Patrick Beck
Organisation: PlatinPower.com GmbH
Address: Muendener Strasse 31
PostalCode: 34123
City: Kassel
CountryCode: DE
Phone: +49.18030553000
Fax: +49.18030553009
Email: Login to show email
2014-01-06T18:03:09+01:00

[Zone-C]
Type: PERSON
Name: Patrick Beck
Organisation: PlatinPower.com GmbH
Address: Muendener Strasse 31
PostalCode: 34123
City: Kassel
CountryCode: DE
Phone: +49.18030553000
Fax: +49.18030553009
Email: Login to show email
2014-01-06T18:03:09+01:00

Who hosts Artikel-fakten.de?

Artikel-fakten.de Web Server Information

Hosted IP Address:188.40.47.211
Hosted Hostname:srv01.platinpower.com
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Apache/2.2.16 (Debian)

HTTP Header Analysis for Artikel-fakten.de

Http-Version: 1.1
Status-Code: 403
Status: 403 Forbidden
Date: Tue, 02 Jun 2015 00:17:28 GMT
Server: Apache/2.2.16 (Debian)
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 994
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Artikel-fakten.de?

Artikel-fakten.de Free SEO Report

Website Inpage Analysis for Artikel-fakten.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Artikel-fakten.de

oderfrvarsieartikelfaktendeampaufdenderdieartikelihre

Longtail Keyword Density for Artikel-fakten.de

KeywordsOccurences
amp35
artikel6
auf6
die6
sie5
fr5
ihre4
der4
oder3
den3
artikel-faktende3
var3

What are the nameservers for artikel-fakten.de?

Artikel-fakten.de Domain Nameserver Information

HostIP AddressCountry
ns.inwx.de 192.174.68.104Austria Austria
ns2.inwx.de 176.97.158.104Austria Austria
ns3.inwx.de 46.165.212.97Germany Germany

Artikel-fakten.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Artikel-fakten.de is a scam?