Arubamediamarketing.it  |  Hosting, Domini, Cloud, E-Security, PEC, Firma, Server | Aruba.it
Low trust score  | 
Aruba.it รจ il leader di mercato in Italia per domini, hosting, cloud, server dedicati, e-security e pratiche online. A fianco degli italiani da 20 anni!




Arubamediamarketing.it Website Information

Website Ranks & Scores for Arubamediamarketing.it

Statvoo Rank Statvoo Rank:H
Alexa Rank Alexa Rank:807,258
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:52%
DMOZ DMOZ Listing:No

Domain Information for Arubamediamarketing.it

Domain Registrar: IT-Nic
Expiration Date:2015-10-21  3 years 6 months 4 weeks ago

Whois information for arubamediamarketing.it

Full Whois Lookup for Arubamediamarketing.it Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Arubamediamarketing.it. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

*********************************************************************
* Please note that the following result could be a subgroup of *
* the data contained in the database. *
* *
* Additional information can be visualized at: *
* http://www.nic.it/cgi-bin/Whois/whois.cgi *
*********************************************************************

Domain: arubamediamarketing.it
Status: ok
Created: 2008-10-21 14:58:03
Last Update: 2016-11-06 00:41:42
Expire Date: 2017-10-21

Registrant
Organization: Aruba S.p.A.
Address: Localita il Palazzetto n. 4
BIBBIENA
52011
AR
IT
Created: 2013-08-06 09:55:43
Last Update: 2013-08-06 09:55:43

Admin Contact
Name: Susanna Santini
Organization: Aruba S.p.A.
Address: Localita il Palazzetto n. 4
BIBBIENA
52011
AR
IT
Created: 2013-08-06 09:55:44
Last Update: 2013-08-06 09:55:44

Technical Contacts
Name: Susanna Santini
Organization: Aruba S.p.A.
Address: Localita il Palazzetto n. 4
BIBBIENA
52011
AR
IT
Created: 2013-08-06 09:55:44
Last Update: 2013-08-06 09:55:44

Registrar
Organization: Aruba s.p.a.
Name: ARUBA-REG
Web: http://www.aruba.it

Nameservers
arudns1.aruba.it
arudns2.aruba.it
arudns3.aruba.it
arudns4.aruba.it

Who hosts Arubamediamarketing.it?

Arubamediamarketing.it is hosted by Aruba S.p.A. in Italy.
Arubamediamarketing.it has an IP Address of 62.149.188.154 and a hostname of 62.149.188.154 and runs Microsoft-IIS/8.5 web server.



Arubamediamarketing.it Web Server Information

Hosted IP Address:62.149.188.154
Hosted Hostname:62.149.188.154
Service Provider:Aruba S.p.A.
Hosted Country:ItalyIT
Location Latitude:42.833
Location Longitude:12.833
Webserver Software:Microsoft-IIS/8.5

HTTP Header Analysis for Arubamediamarketing.it

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache, no-store, must-revalidate
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: deflate
Expires: -1
Server: Microsoft-IIS/8.5
X-UA-Compatible: IE=9
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Content-Security-Policy: frame-ancestors 'self' http://wa.aruba.it https://wa.aruba.it
Date: Mon, 21 Sep 2015 09:23:23 GMT
Content-Length: 39006


Need to find out who hosts Arubamediamarketing.it?

Arubamediamarketing.it Free SEO Report

Website Inpage Analysis for Arubamediamarketing.it

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Arubamediamarketing.it

soluzioni personalizzatemedia minwidth 992pxmarginslide 30f2f2f1 0 eeeeed1data centerdeivar verty chatslider1px 2px 000000cloud monitoringslideprog201704 h2textshadowslidecloudstartup201612 evidenceelettronicabottommainmenucloud backup0px 0px dddslidefatturazione201707 stripe30pxmenuprodotti dropdownmenumaxwidth 991px0px 0pxmedia md 9921199terminictagray0 eeeeed 100aruba businessfontsizetispidservizioevidencemarginleft 130px slidecloudstartup201612sostitutivagestioneofficecloudmenu submenu appendslideprog201704 h2 slideprog201704eeeeed 100titlen2soluzionieeeeed 100 backgroundo481px and maxwidthmaggioriesito webil documentopraticheittrasferiscidddviewmedia minwidthminwidth 481pxstoragemonitoring2falseslidefatturazione201707 titlen2cloud computingfontsize 21px lineheighth1marginslide 30 slidesmaxuntermini e condizionimaggiori dettaglimarchebackgrounde firmaslideprog201704 h4registra000000 slidenewdatacenter17privatedettagli suf2f2f140pxdelmarginslidemdundefinedtoppresalebarslidetoggleche ticloud clouddigitale2px 0px 0px9921199displaymarche temporalifatturazione21pxslideprog201704smsche22px3stripebackuppratichemarginleft 30px slidecloudstartup201612dellamenuprodotti dropdownmenu limargintopmd 99211991px 2pxtitlen12px 000000 slidenewdatacenter17toplanguagebarslidetogglecolor fff fontsizetuocloudsoluzioni data centerrichieditypeoftermini e2pxtuoiwidthwrapdelle0pxchatsliderulwidthrowobjectdocumentialtriminwidthh2 slideprog201704md 9921199 media2px 0pxf2f2f1 0uscoprism 481991pec eslideprog201704 h1 slideprog201704fff fontsize130pxcloud object storagecolocationbullcomputingdiverty chatslidere domini hostingmedia mdpartner eil tuocolor fffsubmenu appenddropdownmenumediapartnermedia smwhitetitle481pxsoluzioni cloudesecuritytuaoffice 365slidenewdatacenter17 titlen3catastale1199pxrinnova21px lineheightnoiif rwidthwrapmarginleft 30pxinformazionirivenditoriif typeoffontsize 21pxlemarginleft 130pxdedicatih1 slideprog201704submenuonline481991ifgraybardedicatodropdownmenu liserver vpsslidefatturazione201707fontweightarea clienti rinnovawindowwidthslidesmaxdettagli000000area clienti8130px slidecloudstartup201612tuttiwnidmconopenslidenewdatacenter17 titlen2sm 481991 mediacloud objectcolormaxwidthslidecloudstartup201612 whitetitle5assistenzacloudmenu submenucerca6slidefatturazione201707 graybarservere condizioniconservazione7nviewpannellohosting0px 2pxbar resizecontattiper ilfunction9921199 media minwidth10 174marketingadsl2px 000000servizitextshadow 1pxcondizionimenuprodottiil9921199 mediah2 slideprog201704 h4pectitlen2 color fffconservazione sostitutivavar verty1px 1px 2pxbcrel48pxsmelsebusinesstemporaliarubaspaziomaxwidth 1199pxslidefatturazione201707 prezzodocumentreadyfunctionweb marketingbuttontextshadow 1px 1pxesecurity pec26pxareavertyif widthwrapslidefatturazione201707 ctagrayslidesmax 3minwidth 992pxecommercehosting e dominiconservatoria1px 1pxtopareaclientislidetogglegreentitletopassistancebarslidetoggleslidenewdatacenter17pec e firmah1 slideprog201704 h20private cloud4object storage481991 media minwidthcloudmenu3pxfffpa0px 2px 0pxweb481991 mediavarsufirmaheightpersonalizzateslidenewdatacenter17 titlen1prezzomedia minwidth 481pxmaggiori dettagli sutitlen2 coloragenziawidthslidelangperhousingpostah4nostroli365 office 3659slideprog201704 h1slidecloudstartup201612992px and maxwidth30 slidesmaxpaddingmarginleftbar30px slidecloudstartup201612nbsp24pxtitlen3truerinnova serviziesecurity pec edocumentopagamentidominiomedia sm 481991resizedomini hostingclienti rinnova servizifontweight 400clienti rinnovaclientieeeeedsito0px dddposta elettronica10pxdatascopri nbsp100 backgroundhosting epicasellafirma digitale991pxlineheightfatturazione elettronica48ee36else ifdae dominiserver dedicatih2office 365 officeslidecloudstartup201612 greentitlealtri servizi992pxappendslidefatturazione201707 titlen10 eeeeedcommercialilineheight 26pxrwidthwrapguidedominisoluzioni datacenter1pxvpsxsjquerymainmenu365 office

Longtail Keyword Density for Arubamediamarketing.it

KeywordsOccurences
color fff font-size10
maggiori dettagli su6
margin-left 30px slide-cloudstartup-2016125
hosting e domini5
termini e condizioni5
481-991 media min-width4
sm 481-991 media4
media min-width 481px4
0 eeeeed 1004
margin-left 130px slide-cloudstartup-2016124
f2f2f1 0 eeeeed4
481px and max-width4
media sm 481-9914
soluzioni data center4
menu-prodotti dropdown-menu li4
0px 2px 0px3
eeeeed 100 background3
office 365 office3
titlen2 color fff3
font-size 21px line-height3
2px 0px 0px3
0px 0px ddd3
e domini hosting3
var verty chatslider3
marginslide 30 slidesmax3
e-security pec e3
cloud object storage3
pec e firma3
2px 000000 slide-newdatacenter173
1px 1px 2px3
md 992-1199 media3
992-1199 media min-width3
media md 992-11993
slide-prog201704 h1 slide-prog2017043
slide-prog201704 h2 slide-prog2017043
h2 slide-prog201704 h43
media min-width 992px3
992px and max-width3
text-shadow 1px 1px3
h1 slide-prog201704 h23
365 office 3653
cloudmenu submenu append3
clienti rinnova servizi3
area clienti rinnova3
1px 2px 0000003
color fff12
fff font-size10
data center10
office 3657
media min-width7
il tuo7
100 background6
maggiori dettagli6
margin-left 30px6
font-size 21px6
dettagli su6
30px slide-cloudstartup-2016125
sito web5
slide-fatturazione201707 titlen25
hosting e5
termini e5
margin-left 130px5
e domini5
e condizioni5
481-991 media5
max-width 1199px4
sm 481-9914
media md4
scopri nbsp4
slide-prog201704 h14
min-width 481px4
min-width 992px4
eeeeed 1004
marginslide 304
slidesmax 34
if rwidthwrap4
bar resize4
130px slide-cloudstartup-2016124
slide-fatturazione201707 titlen14
2px 0000004
f2f2f1 04
0 eeeeed4
area clienti4
max-width 991px4
media sm4
firma digitale4
che ti4
submenu append4
server dedicati4
soluzioni data4
cloud computing4
soluzioni personalizzate4
e-security pec4
aruba business4
menu-prodotti dropdown-menu4
dropdown-menu li4
line-height 26px3
cloud cloud3
slide-cloudstartup-201612 white-title3
slide-cloudstartup-201612 green-title3
slide-cloudstartup-201612 evidence3
web marketing3
0px ddd3
private cloud3
cloud backup3
0px 2px3
2px 0px3
0px 0px3
soluzioni cloud3
partner e3
10 1743
if typeof3
if widthwrap3
e firma3
30 slidesmax3
marche temporali3
cloud object3
fatturazione elettronica3
var verty3
conservazione sostitutiva3
verty chatslider3
else if3
pec e3
slide-fatturazione201707 prezzo3
992-1199 media3
md 992-11993
il documento3
365 office3
posta elettronica3
per il3
altri servizi3
cloudmenu submenu3
h1 slide-prog2017043
rinnova servizi3
slide-prog201704 h23
h2 slide-prog2017043
domini hosting3
slide-prog201704 h43
cloud monitoring3
slide-newdatacenter17 titlen13
font-weight 4003
21px line-height3
slide-newdatacenter17 titlen33
clienti rinnova3
slide-fatturazione201707 gray-bar3
slide-fatturazione201707 stripe3
object storage3
titlen2 color3
1px 1px3
text-shadow 1px3
1px 2px3
server vps3
slide-newdatacenter17 titlen23
000000 slide-newdatacenter173
slide-fatturazione201707 cta-gray3
e45
var31
cloud25
if25
slide-fatturazione20170722
di22
font-size21
function19
il17
nbsp17
media16
slide-cloudstartup-20161215
color15
margin-left15
slide-newdatacenter1715
per15
line-height14
soluzioni14
servizi13
slide-prog20170413
center13
server12
fff12
office11
data11
background11
aruba11
else10
domini10
web10
pec10
09
scopri9
widthslide9
0px9
2px9
19
30px8
true8
su8
slidesmax8
hosting8
le8
titlen28
min-width8
max-width8
titlen17
27
false7
tuoi7
firma7
tua7
f2f2f17
21px7
dominio7
menu-prodotti7
tuo7
clienti7
dettagli6
sm6
open6
bottom6
marginslide6
business6
maggiori6
area6
assistenza6
servizio6
font-weight6
36
documentreadyfunction6
1px6
elettronica6
con6
md6
altri5
submenu5
bull5
widthwrap5
li5
partner5
e-security5
digitale5
130px5
sito5
posta5
rivenditori5
tutti5
un5
fatturazione5
pa5
termini5
rwidthwrap5
xs5
condizioni5
eeeeed5
45
481-9915
commerciali5
praticheit5
991px4
text-shadow4
0000004
titlen34
22px4
width4
481px4
26px4
992px4
1199px4
48ee364
nview4
54
h14
gestione4
vps4
pratiche4
bar4
del4
computing4
ti4
che4
online4
resize4
personalizzate4
undefined4
documento4
dedicati4
dropdown-menu4
64
append4
idm4
jquerymainmenu4
rinnova4
windowwidth4
adsl4
74
richiedi4
guide4
view4
nostro4
agenzia4
white-title3
u3
margin-top3
evidence3
top-language-barslidetoggle3
green-title3
top-presale-barslidetoggle3
mainmenu3
chatslider3
cerca3
contatti3
10px3
trasferisci3
lang3
registra3
row3
topareaclientislidetoggle3
rel3
wn3
bc3
typeof3
verty3
top-assistance-barslidetoggle3
pannello3
object3
storage3
backup3
dedicato3
private3
83
monitoring3
noi3
da3
colocation3
housing3
spid3
dei3
casella3
e-commerce3
spazio3
pagamenti3
informazioni3
marketing3
marche3
sostitutiva3
conservazione3
documenti3
temporali3
catastale3
conservatoria3
della3
height3
pi3
992-11993
24px3
93
button3
cta-gray3
gray-bar3
stripe3
prezzo3
40px3
padding3
cloudmenu3
sms3
delle3
o3
ul3
48px3
display3
3px3
h43
h23
ddd3

What are the nameservers for arubamediamarketing.it?

Arubamediamarketing.it Domain Nameserver Information

HostIP AddressCountry
arudns1.aruba.it 62.149.128.7Italy Italy
arudns2.aruba.it 62.149.132.7Italy Italy
arudns3.aruba.it 95.110.220.7Italy Italy
arudns4.aruba.it 81.2.199.97Czech Republic Czech Republic

Arubamediamarketing.it Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Arubamediamarketing.it is a scam?