The domain name Asgard.xyz is for sale

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

The domain name Asgard.xyz is for sale. Make an offer or buy it now at a set price.



Domain summary

Last updated
2021-09-18
Domain label
asgard
Domain extension
xyz
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Asgard.xyz registered?
A: Asgard.xyz was registered 1 month, 1 week, 2 days, 13 hours, 50 minutes, 18 seconds ago on Saturday, September 18, 2021.
Q: When was the WHOIS for Asgard.xyz last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 2 days, 13 hours, 50 minutes, 18 seconds ago on Saturday, September 18, 2021.
Q: What are Asgard.xyz's nameservers?
A: DNS for Asgard.xyz is provided by the following nameservers:
  • ns1.dan.com
  • ns2.dan.com
  • verification-67e2a8f8.ns3.dan.hosting
Q: Who is the registrar for the Asgard.xyz domain?
A: The domain has been registered at .
Q: What is the traffic rank for Asgard.xyz?
A: Asgard.xyz has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Asgard.xyz each day?
A: Asgard.xyz receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Asgard.xyz resolve to?
A: Asgard.xyz resolves to the IPv4 address 52.58.78.16.
Q: In what country are Asgard.xyz servers located in?
A: Asgard.xyz has servers located in the Germany.
Q: What webserver software does Asgard.xyz use?
A: Asgard.xyz is powered by Openresty webserver.
Q: Who hosts Asgard.xyz?
A: Asgard.xyz is hosted by Mobile Interim Company No.2 SAL in Hesse, Frankfurt Am Main, Germany, 60313.
Q: How much is Asgard.xyz worth?
A: Asgard.xyz has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Asgard.xyz Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Asgard.xyz Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Asgard.xyz

H1 Headings

1 :
  1. Asgard.xyz

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

4 :
  1. Estimated VAT overview
  2. Estimate in GBP
  3. Buy this domain
  4. The simple, safe way to buy domain names

H5 Headings

7 :
  1. Buyer Protection Program
  2. Fast & easy transfers
  3. Hassle free payments
  4. Value Added Tax
  5. Conversion
  6. USD $7,888
  7. $7,888

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-47793354-3

Links - Outbound (nofollow)

0:

Keyword Cloud for Asgard.xyz

ownershipcounttoolessourtrywedomain ownershipi18nextendi18ntranslationsenusprotectionmaximumdomainyouequalpageoffershouldwithinallpleaseprovidedrecordhavenotalreadyyou have providedmostyou have0canfreeenterhave providedvatusdminimumbusinessescharacterotherispaymentnamethan or equal1 characterotherisless thanownership transfertransferampthanchargedvatyourcharged vateubuy

Who hosts Asgard.xyz?

Asgard.xyz Hosting Provider Information

Hosted IP Address:52.58.78.16
Hosted Hostname:52.58.78.16
Service Provider:Mobile Interim Company No.2 SAL
Hosted Country:GermanyDE
Location Latitude:50.1188
Location Longitude:8.6843
Webserver Software:openresty

Is "Mobile Interim Company No.2 SAL" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
Mobile Interim Company No.2 SAL
0.3979%

HTTP Header Analysis for Asgard.xyz

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Sat, 18 Sep 2021 07:31:31 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
X-Download-Options: noopen
X-Permitted-Cross-Domain-Policies: none
Referrer-Policy: strict-origin-when-cross-origin
ETag: W/"2220ff8215116f954859d9a3b8d9f6c4"
Cache-Control: max-age=0, private, must-revalidate
X-Request-Id: 25f4642e-ce74-4dd9-9faa-3af17b6602e5
X-Runtime: 0.038893
Content-Encoding: gzip

Asgard.xyz Domain Nameserver Information

HostIP AddressCountry
ns1.dan.com 18.200.113.118
ns2.dan.com 3.120.163.96
verification-67e2a8f8.ns3.dan.hosting 3.126.142.17


Need to find out who hosts Asgard.xyz?


Domain Registration (WhoIs) information for Asgard.xyz

 Domain Name: ASGARD.XYZ
Registry Domain ID: D72680489-CNIC
Registrar WHOIS Server: whois.hkdns.hk
Registrar URL: http://www.hkdns.hk
Updated Date: 2021-08-17T17:11:57.0Z
Creation Date: 2018-07-23T02:37:14.0Z
Registry Expiry Date: 2022-07-23T23:59:59.0Z
Registrar: West263 International Limited
Registrar IANA ID: 1915
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: Y Swetha
Registrant State/Province: Telangana
Registrant Country: IN
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: NS1.DAN.COM
Name Server: NS2.DAN.COM
DNSSEC: unsigned
Billing Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +852.35979075
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-09-18T07:32:15.0Z > IMPORTANT INFORMATION ABOUT THE DEPLOYMENT OF RDAP: please visit
https://www.centralnic.com/support/rdap

Websites with Similar Names

Asgar.eu
asgar.eu is available for purchase - Sedo.com
Asgar.info
Asgar Yousef Ghasriki
Asgar.or.id
Organisasi Asli Garut
Asgaragedoor.com
A & S Garage Door Co home page
Asgaragedoors.com
HugeDomains.com
Asgaragusgardener.com
asgaragusgardener.com
Asgarali.com
Home - Asgarali Nuruddin & Co.
Asgaranco.com
asgaranco.com pending validation

Recently Updated Websites

Jeromeleroy.social (3 seconds ago.)Sata.world (3 seconds ago.)Thinkingtank.org (5 seconds ago.)Divoratours.com (5 seconds ago.)Hubapub.com (6 seconds ago.)Balingpressmachine.com (7 seconds ago.)Stgeorgedivinitycollege.com (7 seconds ago.)Blackstarconcrete.com (9 seconds ago.)Dndfarmsupply.com (9 seconds ago.)Petitt.us (11 seconds ago.)Haldonbelvedere.co.uk (11 seconds ago.)Vintagesynth.com (12 seconds ago.)Mnsch.com (12 seconds ago.)Randiandmorganwedding.com (12 seconds ago.)Heals-assistants.com (13 seconds ago.)Beltasia.biz (13 seconds ago.)Learntechu.com (13 seconds ago.)Hoistring.com (15 seconds ago.)Mybutterflyjourney.com (16 seconds ago.)Siennasworld.com (17 seconds ago.)Abacus.asia (19 seconds ago.)17islands.com (19 seconds ago.)Freysupply.com (19 seconds ago.)Emailprocessingservice.com (20 seconds ago.)Ramayon.com (21 seconds ago.)Behavioress.com (22 seconds ago.)10bestvirtualrealitycompanies.com (22 seconds ago.)Primaveralife.com (22 seconds ago.)Aftertherein.com (23 seconds ago.)Safirbet714.com (23 seconds ago.)

Recently Searched Keywords

hanuman worship (1 second ago.)cheifet (1 second ago.)wabash (1 second ago.)secondary metabolites (2 seconds ago.)sungai (3 seconds ago.)bioniq life (7 seconds ago.)background rgba0 (10 seconds ago.)trjsap (11 seconds ago.)set any (11 seconds ago.)fiat tempra avito maroc (12 seconds ago.)bathroom cleaning (13 seconds ago.)gallery-item-hoverdefaultnothide-hoverbeforebackground2f2e2e importantcomp-jepdpftp (15 seconds ago.)best orgasms help (18 seconds ago.)security card (18 seconds ago.)cost (18 seconds ago.)男排女将粤语版 (20 seconds ago.)write my dissertation (20 seconds ago.)dataform (21 seconds ago.)student accounts (22 seconds ago.)econmico incluso social (25 seconds ago.)window cleaning near me (27 seconds ago.)bionique d (28 seconds ago.)httpsnadanuimediapipeline (29 seconds ago.)zyrtec side effects (29 seconds ago.)damaged stucco (30 seconds ago.)what does pastiin.com stand for (30 seconds ago.)science-fiction (32 seconds ago.)одинцово и ярмарка на петра и павла (33 seconds ago.)双色球21057期 致远狂客诗谜 (33 seconds ago.)0s backgroundrgba0 (34 seconds ago.)