Ashtimber.co.uk Favicon Ashtimber.co.uk

Ashtimber.co.uk Website Thumbnail
Checking...
Joinery | Ash Timber | Manchester | Rochdale | Middleton | Oldham

Safety: Low trust score
Year Founded: 15
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-12
Category: This site has not been categorized yet

Timber Supplies, Fencing, Joinery, Custom mouldings, Hardware, Joinery Manchester, Bolton, Bury, Rochdale, Chadderton, Oldham, Failsworth, Cheetham Hill, Royton , Shaw


Domain summary

Domain label
ashtimber
Domain extension
co.uk
Domain registered:
15-Oct-2007
Domain updated:
08-Oct-2020
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is ashtimber.co.uk ranked relative to other sites:

Percentage of visits to ashtimber.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Ashtimber.co.uk registered?
A: Ashtimber.co.uk was registered 13 years, 1 month, 1 week, 3 days, 10 hours, 42 minutes, 34 seconds ago on Monday, October 15, 2007.
Q: When was the WHOIS for Ashtimber.co.uk last updated?
A: The WHOIS entry was last updated 1 month, 2 weeks, 3 days, 10 hours, 42 minutes, 34 seconds ago on Thursday, October 8, 2020.
Q: What are Ashtimber.co.uk's nameservers?
A: DNS for Ashtimber.co.uk is provided by the following nameservers:
  • ns0.wixdns.net
  • ns1.wixdns.net
Q: Who is the registrar for the Ashtimber.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Ashtimber.co.uk?
A: Ashtimber.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Ashtimber.co.uk each day?
A: Ashtimber.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Ashtimber.co.uk resolve to?
A: Ashtimber.co.uk resolves to the IPv4 address 23.236.62.147.
Q: In what country are Ashtimber.co.uk servers located in?
A: Ashtimber.co.uk has servers located in the United States.
Q: What webserver software does Ashtimber.co.uk use?
A: Ashtimber.co.uk is powered by webserver.
Q: Who hosts Ashtimber.co.uk?
A: Ashtimber.co.uk is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Ashtimber.co.uk worth?
A: Ashtimber.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Ashtimber.co.uk?

Ashtimber.co.uk Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Ashtimber.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Mon, 12 Oct 2020 00:33:14 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.ashtimber.co.uk/
content-language: en
X-Wix-Request-Id: 1602462794.553508799403364814813
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: 6ivkWfREES4Y8b2pOpzk7Owfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVivd4o9HMoDTVPhK7/s60Jl,2d58ifebGbosy5xc FRaluv1yqLElQPlGdRO2X1N/B7aDggNl9Bjy4g6LeBq0vAUxttpQxEIbbIuzXr6HdNMYg==,2UNV7KOq4oGjA5 PKsX47BfGVDRiOALEihGw5cYd8uQ=,m0j2EEknGIVUW/liY8BLLs50IRXaQfdUyjQx5gSPOXw=,1wy2ILu/S4rlWT/R4rqCrRvtFePibz XKeP ljtsw5o=,qJS91GsscGZlb16v 8nwmP l4rXTjRs//30u84MRsmwPUN6zYCeYUhP LoeE7OiY,pglrwSJCjYpA6tXbCNiuHJgJheWlmWKt/8y vYAexj8 Ep VHx2BwjZPMJkAUv7IoOPAC ukfVJ4IID7fxbkGA==
Cache-Control: no-cache
Expires: -1

Ashtimber.co.uk Domain Nameserver Information

HostIP AddressCountry
ns0.wixdns.net 216.239.32.101
ns1.wixdns.net 216.239.34.101


Need to find out who hosts Ashtimber.co.uk?


Domain Registration (WhoIs) information for Ashtimber.co.uk

 Domain name:
ashtimber.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 05-Feb-2019

Registrar:
123-Reg Limited t/a 123-reg [Tag = 123-REG]
URL: http://www.123-reg.co.uk

Relevant dates:
Registered on: 15-Oct-2007
Expiry date: 15-Oct-2021
Last updated: 08-Oct-2020

Registration status:
Registered until expiry date.

Name servers:
ns0.wixdns.net
ns1.wixdns.net

WHOIS lookup made at 01:33:15 12-Oct-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Ashtimber.co.uk Free SEO Report

Website Inpage Analysis for Ashtimber.co.uk

H1 Headings

3 :
  1. FREE Local Delivery
  2. over £200
  3. ​Current Vacancies

H2 Headings

5 :
  1. 0161 7060 074
  2. [email protected]
  3. Call Today!
  4. Welcome to Ash Timber
  5. Fence Panels Made to Order

H3 Headings

0 :

H4 Headings

9 :
  1.  Decking Prices 
  2.  
  3.  Decking 
  4.  Joinery Manufacture  
  5. Fencing
  6.  Fencing 
  7. Timber Supplies
  8. Bespoke Mouldings

H5 Headings

0 :

H6 Headings

12 :
  1. Get a free estimate! 
  2. Call Now: 0161 7060 074
  3. Opening Hours
  4. Monday 08.00 – 17.00 Tuesday 08.00 – 17.00 Wednesday 08.00 – 17.00 Thursday 08.00 – 17.00 Friday 08.00 – 17.00 Saturday 08.00 – 17.00 Sunday Closed
  5. Find Us
  6. Contact Us
  7. Grimshaw Lane,
  8. Middleton,
  9. Manchester
  10. M24 2AF
  11. Email: [email protected]
  12. Tel: 0161 7060 074

Total IFRAMEs

1 :

Total Images

7 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

22:
  1. https://www.ashtimber.co.uk
    https://www.ashtimber.co.uk
  2. Ashtimber  Decking Prices 
    https://www.ashtimber.co.uk/decking
  3. Ashtimber  
    https://www.ashtimber.co.uk/decking
  4. https://www.ashtimber.co.uk/sleepers
    https://www.ashtimber.co.uk/sleepers
  5. Ashtimber  Decking 
    https://www.ashtimber.co.uk/decking
  6. https://www.ashtimber.co.uk/vacencies
    https://www.ashtimber.co.uk/vacencies
  7. Ashtimber ​Current Vacancies
    https://www.ashtimber.co.uk/vacencies
  8. Ashtimber #mask-comp-joy5ukotimg-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://www.ashtimber.co.uk/joinery-manufacturer
  9. https://www.ashtimber.co.uk/joinery-manufacturer
    https://www.ashtimber.co.uk/joinery-manufacturer
  10. Ashtimber #mask-comp-jpa39qeuimg-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://www.ashtimber.co.uk/fence-panels
  11. https://www.ashtimber.co.uk/fence-panels
    https://www.ashtimber.co.uk/fence-panels
  12. Ashtimber #mask-comp-joy6clybimg-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://www.ashtimber.co.uk/timber
  13. https://www.ashtimber.co.uk/timber
    https://www.ashtimber.co.uk/timber
  14. Ashtimber #mask-comp-jpa3fndaimg-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://www.ashtimber.co.uk/skirting-boards-arcitraies
  15. https://www.ashtimber.co.uk/bespoke-moludings
    https://www.ashtimber.co.uk/bespoke-moludings
  16. Ashtimber Home
    https://www.ashtimber.co.uk
  17. Ashtimber Services
    https://www.ashtimber.co.uk/services-1
  18. Ashtimber Products
    https://www.ashtimber.co.uk/products
  19. Ashtimber Gallery
    https://www.ashtimber.co.uk/gallery
  20. Ashtimber About
    https://www.ashtimber.co.uk/about
  21. Ashtimber Testimonials
    https://www.ashtimber.co.uk/testimonials
  22. Ashtimber Contact
    https://www.ashtimber.co.uk/contact

Links - Internal (nofollow)

0:

Links - Outbound

2:
  1. https://goo.gl/maps/x1LRnXKKfq52
    https://goo.gl/maps/x1LRnXKKfq52
  2. https://www.facebook.com/ashtimberjoinery/
    https://www.facebook.com/ashtimberjoinery/

Links - Outbound (nofollow)

0:

Keyword Cloud for Ashtimber.co.uk

galleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryitemhover3normal normal 15px14emcansvgn nninfosvgtypeshapeviewbox0 0sided fenceinotprogallerylovedcompjx0v6iu648 48compjx0v6iu6normalrochdalenew10helveticaneuew0255roma helveticaneuew1055roma0 0positionabsolutetop0right0bottom0left0buttoncompjx0v6iu6borderwidth2px borderstylesolidbordercolorrgba249helveticaw01lighthelveticaw02lightsansseriftextdecoration compjx0v6iu6 progalleryinlinestylesboltonmuseow01700serif21px14em1backgroundcolorrgba255shawmetakeywordsseodoorshelveticaneuew0255romamanchester middleton303030colorrgb4813galleryitemcontainer galleryitemwrapper galleryitemhover100widthfalseinfoelementtitleitemfontslideshowfont normal normalupvisitorsstrokewidth 0normal 22px27pxinfoelementdescriptioncompjx0v6iu6 progalleryinlinestylesprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavnormal normal 21px14em15px14em museoslabw01100serifitemdescriptionfontcolorslideshow255 importantcompjx0v6iu6 progalleryinlinestylesgalleryitemcontainer galleryitembottominforgba255 255buttoncompjx0v6iu6 progalleryinlinestylesnninfosvgtypeshapeviewbox0 0 200255 1 stylejofp31ptnavcontainerhelveticaneuew0155roma helveticaneuew0255romagetultxtnew48 importantfontnormal normal15px14em museoslabw01100serifcolorrgb48inotprogallerylovedcompjx0v6iu6 profullscreenwrappershawmetakeywordsseopagetitleseojoinery ash timberprogalleryinlinestylesshawmetakeywordsseodoors stairs windowsmuseoslabw01100seriftextdecoration compjx0v6iu6galleryitemgalleryitemvideonormal 16px14emimportantzindex50helveticaneuew1055romaacompjx0v6iu6 profullscreenwrappern4strokewidthbolton bury rochdalecolor303030manchester boltonselectdatapreviewfocusultxtnew ol25px14em6b0b0b0middleton oldhamtypemetapropsnamedescriptioncontenttimber suppliestopautobottom0galleryitemdescriptioncompjx0v6iu6 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatormuseoslabw01100serifcolorrgb48 48galleryitemhoverbeforeitemopacity 303030backgroundrgba113 11211helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjx0v6iu6compjx0v6iu6royton shawmetakeywordsseopagetitleseojoinerymanchester rochdalestairs windows shedtransformnorth manchesterashmuseoslabw01100serifcolorrgb48middleton bolton burystylejofp31ptrepeaterbuttonlabelimportantleftautodivprogalleryparentcontainerrgba255positionfixednormal normalgalleryitemhoverdefaultforcehoverbeforecompjx0v6iu6fullscreensidebarsocialgalleryitemhoverdefaultforcehoverbeforecompjx0v6iu6 progalleryinlinestylesgalleryitemcontainerprogallerymobileindicatorstylejofp31ptnavcontainerarrowstylejofp31ptnavcontainerrightdirection255 importantcompjx0v6iu6fencing decking cuttingstylejofp31ptnavcontainerarrowstylejofp31ptnavcontainerleftdirectionmouldings hardware204 204importantfontnormal normal normal2stroke48 48 importantfontnormalhill royton shawmetakeywordsseopagetitleseojoinerytimber manchestermadeprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitembottominforochdale middleton oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoineryrgba255 255 255us todaycompjx0v6iu6 profullscreenwrappermuseoslabw01100seriffullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarcolorrochdale chadderton oldham0 200galleryitemcontainerprogallerymobileindicator galleryitembottominfo980pxmuseow01700serifitemfontcolorslideshow 303030colorrgb48paymentmanchesterborderstylesolidbordercolorrgba249 249fence panels fencingcolor3c1d17manchester middleton bolton255 255 1normal 15px14emroyton shawmetakeywordsseodoors stairsn n nninfosvgtypeshapeviewbox0borderwidth2px borderstylesolidbordercolorrgba249 249infoelementcustombuttonwrapper buttoncompjx0v6iu6 progalleryinlinestylesash timberfff strokewidth 0customnormal 21px14em14galleryslideshowinfo303030backgroundrgba113 112 112helveticacontactcustombuttonwrapperinotprogallerylovedcompjx0v6iu6 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles255 255 importantcompjx0v6iu6galleryitemwrapper galleryitemhover svggalleryitemtitlecompjx0v6iu6 progalleryinlinestylesyears0pxrgba0your payment methodfailsworthcheetham hillstylejofp31ptnavcontainerarrowstylejofp31ptnavcontainercenterdirection255compjx0v6iu6 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesgalleryitemhoverrochdale middleton oldhamtypemetapropsnamedescriptioncontenttimbernorthcheetham hill roytoninfoelementtitlecompjx0v6iu6 progalleryinlinestylespanels fencing deckingwindows shed fencedeckingmarginleftgalleryitemcontainerprogallerymobileindicator galleryitemtopinfo15px14emmuseoslabw01100serifitemdescriptionfontcolorslideshow 303030colorrgb48 48importantcompjx0v6iu6 progalleryinlinestylesfullscreenmobilebarchaddertoninotprogallerylovednotinfoelementlovedcompjx0v6iu6 progalleryinlinestyles22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjx0v6iu6methodfont normalgalleryslideshowinfo infoelementtitleitemfontslideshow normalimportantcompjx0v6iu6oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinerymarginleft calc100selectdatapreviewhoverprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemtopinfoimportantcompjx0v6iu6 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorrochdale middletongalleryslideshowinfo galleryitemtitlecompjx0v6iu6importantfontnormal303030backgroundrgba113n nstylejuv5pf5svideoplayer2725432193rootfff strokewidthrochdale chaddertonneue helveticaneuew0155romaabsolutetopopennormal 15px14em museoslabw01100seriftextdecorationtxtnew ulnninfosvgtypeshapeviewbox0bury rochdale chaddertongalleryslideshowinfo galleryitemtitlecompjx0v6iu6 progalleryinlinestylesgalleryitemwrapper galleryitemgalleryitemvideoselectdataerrortrue255compjx0v6iu6 profullscreenwrapperstylejofp31ptnavcontainer1backgroundcolorrgba255 255 2551borderradius0shed48compjx0v6iu6 profullscreenwrappermarginleft calc100 980px48fontnormal normalffffffcolorrgb255 255 255compjx0v6iu6calc100 980pxcalc100 980px 05helveticaneuew0255roma helveticaneuew1055roma helvetica255 1shawmetakeywordsseopagetitleseojoineryoldhamtypemetapropsnamedescriptioncontenttimber supplies fencinghelveticaneuew0155romagalleryitemhoverbeforeitemopacity12acompjx0v6iu6 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesstylejofp31ptnavcontainersvgcontainerarialartgalleryitemcontainerprogallerymobileindicator galleryitemwrappernormal 22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationffffffprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarfencing deckingtimber manchester rochdalesuppliesstylejofp31ptnavcontainerleftdirectionbackgroundcolor ffffffinfoelementtitleitemfontslideshow normaloldham failsworth cheethampositionstaticboxshadow000progalleryinlinestyles galleryitemcontainer galleryslideshowinfofullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialfencing48compjx0v6iu6compjx0v6iu6 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatormiddleton manchestergalleryslideshowinfo infoelementtitleitemfontslideshowpositionabsolutetop0right0bottom0left0pointereventsnoneroytongalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryslideshowinfomiddleton boltonimportantcompjx0v6iu6 progalleryinlinestyles galleryitemcontainereasecolor ffffffjoinery custom mouldingsup yourfailsworth cheetham hillmanchester rochdale middletontxtnewmiddleton oldhamtypemetapropsnamedescriptioncontenttimber04s easetimbercompjx0v6iu6 progalleryinlinestylespositionfixed importantleftauto importantzindex50helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationmanufactureoverflowhiddennormal normal 25px14emgalleryitemcontainer galleryitemwrapperhelveticaw01lighthelveticaw02lightsansseriftextdecorationpositionstaticboxshadow000 0 005museow01700seriftextdecoration compjx0v6iu648 48fontnormal normalgalleryitemcontainerstairsborderradius0galleryitemcontainer galleryitemtopinforgba0 0 0112 11248 48compjx0v6iu6 profullscreenwrappermouldings hardware joineryifinfoelementdescriptioncompjx0v6iu6object112 06importantleftauto importantzindex50fullscreennavblackleyolgalleryitemtitlecompjx0v6iu6failsworth cheetham980px 0515px14em museoslabw01100seriftextdecorationcompjx0v6iu6 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesprogalleryinlinestyles galleryitemcontainerprogallerymobileindicatorchadderton oldham failsworth255 255compjx0v6iu6 progalleryinlinestyleswindowsvarinfoelementcustombuttonwrapperol ul255compjx0v6iu6 progalleryinlinestylesnormal 15px14em museoslabw01100serifcolorrgb48galleryitemwrapper galleryslideshowinfogalleryitemcontainer galleryitemwrapper galleryslideshowinfogalleryslideshowinfo galleryitemdescriptioncompjx0v6iu6 progalleryinlinestylesfill15px14em museoslabw01100serifcolorrgb48 4848 48fontnormalmiddleton oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinery303030colorrgb48 48fencing joinery customroyton shawmetakeywordsseopagetitleseojoinery ashgalleryitemhoverdefaultnothidehoverbeforebackground303030 importantcompjx0v6iu6 progalleryinlinestyles22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationnormal normal 22px27pxbuttoncompjx0v6iu6 profullscreenwrapperash timber manchesteranyborderwidth2pxsupplies fencingstylejofp31ptnavcontainerarrow stylejofp31ptnavcontainersvgcontainerhill roytongalleryitemtitlecompjx0v6iu6 progalleryinlinestyles galleryitemcontainergalleryitemdescriptioncompjx0v6iu6 progalleryinlinestyles galleryitemcontainerulsupplies fencing joineryborderstylesolidbordercolorrgba249 249 249over16px14em museow01700serifimportantwindows shed255 255compjx0v6iu648 importantcompjx0v6iu6nninfosvgtypeshapeviewbox0 0infoelementtitleitemfontslideshow normal normalpositionstaticboxshadow000 015px14em museoslabw01100seriftextdecoration compjx0v6iu6normal normal normalgalleryitemdescriptioncompjx0v6iu6 progalleryinlinestylesjoinery manchester boltonclickgalleryitemtitlecompjx0v6iu6 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorgalleryitemdescriptioncompjx0v6iu6galleryitemtextonlinenormal normal 16px14em303030backgroundrgba113 11206yourprogalleryinlinestyles galleryitemcontainer galleryitemwrapper130 0255 255galleryslideshowinfo galleryitemdescriptioncompjx0v6iu6profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialfill fffuspanelsbuttoncompjx0v6iu6 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorneue helveticaneuew0155roma helveticaneuew0255romaffflangleyshed fencedisplaynonemiddleton oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinery ash9303030color303030fenceinotprogallerylovednotinfoelementlovedcompjx0v6iu6profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesbuttonnotprogallerylovednotinfoelementlovedcompjx0v6iu6 progalleryinlinestylesnormal 15px18px helveticaw01lighthelveticaw02lightsansseriftextdecorationinfoelementcustombuttonwrapper buttoncompjx0v6iu6fill fff strokestylejofp31ptnavcontainerarrownormal 25px14emhill255compjx0v6iu6galleryitemcontainer galleryslideshowinfo48fontnormal normal normal112 06 importantcompjx0v6iu6fullscreenviewfullscreenbrightprofullscreeninlinestylesstylejofp31ptnavcontainerrightdirectionshawmetakeywordsseodoors stairspositionfixed importantleftautocompjx0v6iu6 progalleryinlinestyles galleryitemcontainerinfoelementtitlecompjx0v6iu6joinery manchesterhardware48 importantfontnormaloldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinery ash timbermanchester bolton burygalleryslideshowinfo svg249 1backgroundcolorrgba255 255000lb1itemscontainerhelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romamiddletonyouffffffcolorrgb255normal 15px14em museoslabw01100serifitemdescriptionfontcolorslideshowroyton shawmetakeywordsseodoorsgalleryitemwrapper galleryslideshowinfo svgcalc10016px14emhardware joinery manchestergalleryitemwrapperstroke fff1 stylejofp31ptnavcontainerbuttoncompjx0v6iu6 progalleryinlinestyles galleryitemcontainerprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryslideshowinfooldirrtl15px14em museoslabw01100serifitemdescriptionfontcolorslideshow 303030colorrgb48guaranteehelveticaw01lighthelveticaw02lightsansseriftextdecoration compjx0v6iu6oldhamtypemetapropsnamedescriptioncontenttimber suppliesgalleryitemwrapper galleryitemhoverfont0bolton bury48 importantcompjx0v6iu6 progalleryinlinestylesfencing joineryshed fence panels1margin0lineheightnormalletterspacingnormal txtnewprofullscreenwrapperfff stroketrymuseow01700serifitemfontcolorslideshow06 importantcompjx0v6iu6255 255compjx0v6iu6 profullscreenwrapperboardscheethamtransparentnormal normal 15px18px7shawmetakeywordsseopagetitleseojoinery ashgalleryitemhoverdefaultnothidehoverbeforebackground303030n nninfosvgtypeshapeviewbox0galleryitemcontainerprogallerymobileindicator galleryslideshowinforgba0 0progalleryinlinestyles galleryitemcontainer galleryitemtopinfochadderton oldham0800249 249today112 112 06contact us todayimportantfontnormal normal48 485joineryjoinery customfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialstroke fff strokewidth303030colorrgb48 48 48oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimberlogoheader1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinery ash48compjx0v6iu6 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesneue249 1backgroundcolorrgba255museow01700serifitemfontcolorslideshow 303030colorrgb48 48fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavcustombuttonwrapper buttoncompjx0v6iu6 progalleryinlinestylesoldhamtypemetapropsnamedescriptioncontenttimber249 249 1backgroundcolorrgba255selectdatapreviewerror stylejofp31ptnavcontainerarrow06 importantcompjx0v6iu6 progalleryinlinestylesfence panelsborderstylesolidbordercolorrgba249panels fencingmuseow01700seriftextdecorationnorthwest1backgroundcolorrgba255 255galleryitemtopinfomuseoslabw01100serifitemdescriptionfontcolorslideshow 303030colorrgb48stylejrgkbxnhbgyour payment15px18px helveticaw01lighthelveticaw02lightsansseriftextdecorationstrc1dataresponsiveprogalleryinlinestyles galleryitemcontainer galleryitembottominfopayment methodgalleryitembottominfogalleryitemhoverdefaultnothidehoverbeforebackground303030 importantcompjx0v6iu6progalleryinlinestyles galleryitemcontainermouldingsfullscreensocialgalleryitemhover svgnormal 15px18pxstrc1inlinecontent15px18px helveticaw01lighthelveticaw02lightsansseriftextdecoration compjx0v6iu6bury rochdalestylejofp31ptnavcontainercenterdirectionhill royton shawmetakeywordsseodoorsbury15px18pxnormal 16px14em museow01700serif22px27pxacompjx0v6iu6backgroundcolorhardware joinery0800 1700profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocialdecking cuttingoldham failsworthfff stroke fffsolidmuseoslabw01100seriftextdecorationoldham8storesidedhelveticaneuew1055roma helvetica arial48 48 importantcompjx0v6iu6custombuttonwrapper buttoncompjx0v6iu604sselectdatapreviewerrorbuttoncompjx0v6iu6 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesmargin0lineheightnormalletterspacingnormalhelveticaneuew1055roma helveticacuttingselectfocusstairs windowscustom mouldings hardwaregalleryitemhoverbeforeitemopacity 303030backgroundrgba113selecthovermuseoslabw01100serifitemdescriptionfontcolorslideshowup your paymentprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemwrapper48fontnormalffffffcolorrgb255 255helvetica arialhelveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjx0v6iu6 progalleryinlinestylesstylejuv5pf5scontact uscustom mouldingsbuttonnotprogallerylovednotinfoelementlovedcompjx0v6iu6

Longtail Keyword Density for Ashtimber.co.uk

KeywordsOccurences
calc100 980px 0543
margin-left calc100 980px43
normal normal normal34
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
pro-galleryinline-styles gallery-item-container gallery-item-wrapper29
normal normal 15px14em25
bolton bury rochdale16
failsworth cheetham hill16
oldham failsworth cheetham16
chadderton oldham failsworth16
bury rochdale chadderton16
rochdale chadderton oldham16
cheetham hill royton16
importantfontnormal normal normal15
timber manchester rochdale15
ash timber manchester15
gallery-item-container gallery-item-wrapper gallery-item-hover14
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-item-hover14
font normal normal11
manchester rochdale middleton10
custom-button-wrapper buttoncomp-jx0v6iu6 pro-galleryinline-styles10
manchester bolton bury10
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-slideshow-info10
gallery-item-container gallery-item-wrapper gallery-slideshow-info10
importantcomp-jx0v6iu6 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator9
fill fff stroke9
fff stroke fff9
stroke fff stroke-width9
fff stroke-width 09
48 48 importantfontnormal9
48 importantfontnormal normal9
joinery custom mouldings8
mouldings hardware joinery8
112 112 068
hardware joinery manchester8
joinery manchester bolton8
buttoncomp-jx0v6iu6 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator8
custom mouldings hardware8
buttoncomp-jx0v6iu6 pro-galleryinline-styles gallery-item-container8
normal 15px14em museo-slab-w01-100seriftext-decoration8
supplies fencing joinery8
fencing joinery custom8
303030colorrgb48 48 487
comp-jx0v6iu6 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jx0v6iu67
importantcomp-jx0v6iu6 pro-galleryinline-styles gallery-item-container7
normal 15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration7
normal normal 15px18px7
comp-jx0v6iu6 pro-galleryinline-styles gallery-item-container7
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jx0v6iu6 pro-galleryinline-styles7
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
middleton bolton bury6
manchester middleton bolton6
shed fence panels6
stairs windows shed6
info-element-custom-button-wrapper buttoncomp-jx0v6iu6 pro-galleryinline-styles6
pro-galleryinline-styles gallery-item-container gallery-slideshow-info6
windows shed fence6
pro-galleryinline-styles gallery-item-container gallery-item-bottom-info6
06 importantcomp-jx0v6iu6 pro-galleryinline-styles6
112 06 importantcomp-jx0v6iu66
pro-galleryinline-styles gallery-item-container gallery-item-top-info6
normal normal 25px14em6
gallery-item-descriptioncomp-jx0v6iu6 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
gallery-item-descriptioncomp-jx0v6iu6 pro-galleryinline-styles gallery-item-container5
gallery-item-titlecomp-jx0v6iu6 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
gallery-item-titlecomp-jx0v6iu6 pro-galleryinline-styles gallery-item-container5
n nninfosvgtypeshapeviewbox0 04
n n nninfosvgtypeshapeviewbox04
249 1background-colorrgba255 2554
middleton oldhamtypemetapropsnamedescriptioncontenttimber supplies4
rochdale middleton oldhamtypemetapropsnamedescriptioncontenttimber4
inotpro-gallery-lovedcomp-jx0v6iu6 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
acomp-jx0v6iu6 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
255 255 importantcomp-jx0v6iu64
gallery-item-wrapper gallery-slideshow-info svg4
border-width2px border-stylesolidborder-colorrgba249 2494
border-stylesolidborder-colorrgba249 249 2494
rgba255 255 2554
rgba0 0 04
249 249 1background-colorrgba2554
hill royton shawmetakeywordsseopagetitleseojoinery4
255 1 style-jofp31ptnavcontainer4
255 255 14
255 importantcomp-jx0v6iu6 pro-galleryinline-styles4
oldhamtypemetapropsnamedescriptioncontenttimber supplies fencing4
gallery-item-wrapper gallery-item-hover svg4
15px14em museo-slab-w01-100serifcolorrgb48 484
gallery-slideshow-info gallery-item-descriptioncomp-jx0v6iu6 pro-galleryinline-styles4
303030backgroundrgba113 112 1124
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jx0v6iu6 pro-galleryinline-styles4
22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jx0v6iu64
gallery-item-hoverdefaultnothide-hoverbeforebackground303030 importantcomp-jx0v6iu6 pro-galleryinline-styles4
normal 22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
normal normal 22px27px4
museo-w01-700serif--itemfontcolorslideshow 303030colorrgb48 484
normal 15px14em museo-slab-w01-100serifcolorrgb484
info-element-title--itemfontslideshow normal normal4
15px14em museo-slab-w01-100seriftext-decoration comp-jx0v6iu64
48 48 importantcomp-jx0v6iu64
48 importantcomp-jx0v6iu6 pro-galleryinline-styles4
gallery-slideshow-info gallery-item-titlecomp-jx0v6iu6 pro-galleryinline-styles4
gallery-slideshow-info info-element-title--itemfontslideshow normal4
1background-colorrgba255 255 2554
normal normal 21px14em3
rochdale middleton oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinery3
middleton oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinery ash3
oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinery ash timber3
nninfosvgtypeshapeviewbox0 0 2003
shawmetakeywordsseopagetitleseojoinery ash timber3
normal 16px14em museo-w01-700serif3
fencing decking cutting3
normal normal 16px14em3
panels fencing decking3
fence panels fencing3
shawmetakeywordsseodoors stairs windows3
royton shawmetakeywordsseodoors stairs3
up your payment3
royton shawmetakeywordsseopagetitleseojoinery ash3
normal 15px14em museo-slab-w01-100serif--itemdescriptionfontcolorslideshow3
hill royton shawmetakeywordsseodoors3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
gallery-item-hoverbefore--itemopacity 303030backgroundrgba113 1123
ffffffcolorrgb255 255 255comp-jx0v6iu63
museo-slab-w01-100serif--itemdescriptionfontcolorslideshow 303030colorrgb48 483
255 255comp-jx0v6iu6 pro-fullscreen-wrapper3
255comp-jx0v6iu6 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
48 48fontnormal normal3
48fontnormal normal normal3
comp-jx0v6iu6 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
48 48comp-jx0v6iu6 pro-fullscreen-wrapper3
48comp-jx0v6iu6 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
buttoncomp-jx0v6iu6 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
positionstaticbox-shadow000 0 03
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
15px14em museo-slab-w01-100serif--itemdescriptionfontcolorslideshow 303030colorrgb483
255 255comp-jx0v6iu6 pro-galleryinline-styles3
contact us today3
helveticaneuew10-55roma helvetica arial3
helveticaneuew02-55roma helveticaneuew10-55roma helvetica3
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma3
neue helveticaneuew01-55roma helveticaneuew02-55roma3
positionfixed importantleftauto importantz-index503
your payment method3
normal normal94
pro-galleryinline-styles gallery-item-container49
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator49
980px 0543
calc100 980px43
margin-left calc10043
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
gallery-item-container gallery-item-wrapper29
gallery-item-wrapper gallery-item-hover28
normal 15px14em25
importantcomp-jx0v6iu6 pro-galleryinline-styles22
0 021
gallery-item-wrapper gallery-slideshow-info20
255 25517
ash timber16
rochdale chadderton16
cheetham hill16
failsworth cheetham16
bury rochdale16
timber manchester16
bolton bury16
hill royton16
oldham failsworth16
buttoncomp-jx0v6iu6 pro-galleryinline-styles16
chadderton oldham16
importantfontnormal normal15
manchester rochdale15
48 4814
comp-jx0v6iu6 pro-galleryinline-styles14
fence panels13
font normal11
manchester bolton10
rochdale middleton10
112 11210
custom-button-wrapper buttoncomp-jx0v6iu610
gallery-item-descriptioncomp-jx0v6iu6 pro-galleryinline-styles10
gallery-item-titlecomp-jx0v6iu6 pro-galleryinline-styles10
fff stroke-width9
303030colorrgb48 489
48 importantfontnormal9
stroke-width 09
fill fff9
stroke fff9
fff stroke9
joinery manchester9
custom mouldings8
joinery custom8
hardware joinery8
mouldings hardware8
15px14em museo-slab-w01-100seriftext-decoration8
112 068
fencing joinery8
supplies fencing8
255 255comp-jx0v6iu67
ffffffcolorrgb255 2557
margin0line-heightnormalletter-spacingnormal txtnew7
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jx0v6iu67
15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration7
normal 15px18px7
info-element-custom-button-wrapper buttoncomp-jx0v6iu66
gallery-item-container gallery-slideshow-info6
normal 25px14em6
gallery-item-container gallery-item-top-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
gallery-item-container gallery-item-bottom-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
06 importantcomp-jx0v6iu66
stairs windows6
windows shed6
0800 17006
shed fence6
manchester middleton6
middleton bolton6
1 style-jofp31ptnavcontainer5
contact us5
n n5
oldhamtypemetapropsnamedescriptioncontenttimber supplies4
0 2004
info-element-titlecomp-jx0v6iu6 pro-galleryinline-styles4
sided fence4
museo-slab-w01-100serifcolorrgb48 484
info-element-descriptioncomp-jx0v6iu6 pro-galleryinline-styles4
15px14em museo-slab-w01-100serifcolorrgb484
gallery-item-hoverdefaultnothide-hoverbeforebackground303030 importantcomp-jx0v6iu64
museo-slab-w01-100seriftext-decoration comp-jx0v6iu64
nninfosvgtypeshapeviewbox0 04
acomp-jx0v6iu6 pro-fullscreen-wrapper4
middleton oldhamtypemetapropsnamedescriptioncontenttimber4
n nninfosvgtypeshapeviewbox04
inotpro-gallery-lovedcomp-jx0v6iu6 pro-fullscreen-wrapper4
royton shawmetakeywordsseopagetitleseojoinery4
gallery-slideshow-info gallery-item-descriptioncomp-jx0v6iu64
gallery-item-hoverdefaultforce-hoverbeforecomp-jx0v6iu6 pro-galleryinline-styles4
gallery-item-hover svg4
txtnew ul4
303030backgroundrgba113 1124
rgba0 04
rgba255 2554
255 14
1background-colorrgba255 2554
249 1background-colorrgba2554
249 2494
gallery-item-wrapper gallery-itemgallery-item-video4
border-stylesolidborder-colorrgba249 2494
border-width2px border-stylesolidborder-colorrgba2494
background-color ffffff4
color ffffff4
gallery-slideshow-info svg4
22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
gallery-slideshow-info info-element-title--itemfontslideshow4
normal 22px27px4
museo-w01-700serif--itemfontcolorslideshow 303030colorrgb484
info-element-title--itemfontslideshow normal4
255 importantcomp-jx0v6iu64
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jx0v6iu64
gallery-slideshow-info gallery-item-titlecomp-jx0v6iu64
48 importantcomp-jx0v6iu64
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jx0v6iu6 pro-galleryinline-styles4
inotpro-gallery-lovednotinfo-element-lovedcomp-jx0v6iu6 pro-galleryinline-styles4
your payment3
royton shawmetakeywordsseodoors3
shawmetakeywordsseodoors stairs3
04s ease3
panels fencing3
fencing decking3
up your3
selectdata-previewerror style-jofp31ptnavcontainerarrow3
normal 16px14em3
decking cutting3
style-jofp31ptnavcontainerarrow style-jofp31ptnavcontainersvgcontainer3
204 2043
16px14em museo-w01-700serif3
shawmetakeywordsseopagetitleseojoinery ash3
middleton oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinery3
oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinery ash3
positionstaticbox-shadow000 03
normal 21px14em3
north manchester3
helveticaneuew10-55roma helvetica3
positionfixed importantleftauto3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
gallery-item-hoverbefore--itemopacity 303030backgroundrgba1133
museo-w01-700seriftext-decoration comp-jx0v6iu63
255comp-jx0v6iu6 pro-fullscreen-wrapper3
48 48fontnormal3
48fontnormal normal3
comp-jx0v6iu6 pro-fullscreen-wrapper3
48 48comp-jx0v6iu63
48comp-jx0v6iu6 pro-fullscreen-wrapper3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
buttoncomp-jx0v6iu6 pro-fullscreen-wrapper3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
importantleftauto importantz-index503
museo-slab-w01-100serif--itemdescriptionfontcolorslideshow 303030colorrgb483
middleton manchester3
15px14em museo-slab-w01-100serif--itemdescriptionfontcolorslideshow3
255comp-jx0v6iu6 pro-galleryinline-styles3
us today3
helvetica arial3
helveticaneuew02-55roma helveticaneuew10-55roma3
helveticaneuew01-55roma helveticaneuew02-55roma3
neue helveticaneuew01-55roma3
ol ul3
ultxtnew ol3
130 03
payment method3
normal154
pro-galleryinline-styles111
070
gallery-item-wrapper58
gallery-item-containerpro-gallery-mobile-indicator49
gallery-item-container49
146
980px43
calc10043
margin-left43
0543
manchester38
237
background-color37
color36
gallery-slideshow-info32
pro-fullscreen-wrapper32
rochdale31
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-hover28
joinery26
timber26
15px14em25
importantcomp-jx0v6iu622
your22
320
comp-jx0v6iu620
buttoncomp-jx0v6iu619
middleton19
bolton19
positionabsolutetop0right0bottom0left019
chadderton19
fff18
txtnew18
panels18
fence17
bury16
ash16
oldham16
failsworth16
cheetham16
hill16
royton16
importantfontnormal15
style-jofp31ptnavcontainer13
svg12
gallery-item-bottom-info12
gallery-item-top-info12
fencing12
style-jofp31ptnavcontainerarrow11
font11
ul10
custom-button-wrapper10
style-juv5pf5s10
gallery-item-titlecomp-jx0v6iu610
n10
ffffff10
info-element-custom-button-wrapper10
gallery-item-descriptioncomp-jx0v6iu610
fill9
stroke9
stroke-width9
303030colorrgb489
custom9
068
48
58
museo-slab-w01-100seriftext-decoration8
supplies8
mouldings8
museo-w01-700serif8
hardware8
transform8
made7
15px18px7
ffffffcolorrgb2557
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration7
255comp-jx0v6iu67
var7
solid7
ol7
important7
margin0line-heightnormalletter-spacingnormal7
style-jofp31ptnavcontainerarrowstyle-jofp31ptnavcontainercenter-direction6
up6
us6
shed6
windows6
style-jofp31ptnavcontainerarrowstyle-jofp31ptnavcontainerleft-direction6
66
stairs6
style-jofp31ptnavcontainerarrowstyle-jofp31ptnavcontainerright-direction6
08006
76
86
25px14em6
color3c1d175
border-radius05
ultxtnew5
95
ease5
style-juv5pf5svideoplayer2725432193root5
divpro-gallery-parent-container5
payment5
contact5
if5
104
gallery-itemgallery-item-video4
inotpro-gallery-lovednotinfo-element-lovedcomp-jx0v6iu64
museo-slab-w01-100serif4
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jx0v6iu64
b0b0b04
inotpro-gallery-lovedcomp-jx0v6iu64
info-element-title--itemfontslideshow4
gallery-item-hoverdefaultforce-hoverbeforecomp-jx0v6iu64
gallery-item-text4
museo-slab-w01-100serifcolorrgb484
info-element-descriptioncomp-jx0v6iu64
info-element-titlecomp-jx0v6iu64
1background-colorrgba2554
gallery-item-hoverdefaultnothide-hoverbeforebackground3030304
303030backgroundrgba1134
museo-w01-700serif--itemfontcolorslideshow4
border-stylesolidborder-colorrgba2494
manufacture4
border-width2px4
303030color3030304
1border-radius04
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
22px27px4
rgba04
114
0px4
sided4
oldhamtypemetapropsnamedescriptioncontenttimber4
style-jofp31ptrepeaterbuttonlabel4
boards4
you4
124
store4
transparent4
100width4
rgba2554
get4
lb1itemscontainer4
acomp-jx0v6iu64
shawmetakeywordsseopagetitleseojoinery4
nninfosvgtypeshapeviewbox04
online3
click3
fullscreen-social3
fullscreen-mobile-bar3
method3
art3
visitors3
fullscreen-nav3
16px14em3
oldhampageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidmainpagejnerjkmtbgmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimg19vnmetadatapageidmainpageispresetfalseschemaversion10ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleashtimber-logo-header-1pnguri870c1bd372498e75e64369802d7d6aed7bb05cmv2pngdescriptionprivatewidth230height81altartistidnameopacity018colorcolor11aligntypecenterfittingtypefitscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypelinkpropsrelcanonicalhrefhttpswwwashtimbercouktypetitlechildrenjoinery3
new3
open3
cutting3
decking3
shawmetakeywordsseodoors3
northwest3
blackley3
langley3
north3
21px14em3
color3030303
arial3
museo-w01-700seriftext-decoration3
fullscreen-side-bar-social3
strc1inlinecontent3
133
false3
try3
any3
can3
oldirrtl3
years3
over3
strc1data-responsive3
topautobottom03
143
overflowhidden3
neue3
helveticaneuew01-55roma3
helveticaneuew02-55roma3
helveticaneuew10-55roma3
absolutetop3
helvetica3
positionabsolutetop0right0bottom0left0pointer-eventsnone3
style-jrgkbxnhbg3
today3
48comp-jx0v6iu63
selectdata-previewfocus3
48fontnormal3
0003
displaynone3
style-jofp31ptnavcontainersvgcontainer3
gallery-item-hoverbefore--itemopacity3
style-jofp31ptnavcontainerleft-direction3
selecthover3
selectdata-previewhover3
selectfocus3
selectdata-errortrue3
importantz-index503
selectdata-previewerror3
style-jofp31ptnavcontainerright-direction3
style-jofp31ptnavcontainercenter-direction3
04s3
museo-slab-w01-100serif--itemdescriptionfontcolorslideshow3
positionstaticbox-shadow0003
guarantee3
positionfixed3
importantleftauto3
object3

Ashtimber.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Ashtianilab.com
آزمایشگاه دکتر آشتیانی
Ashtiantablo.com
آشتیان تابلو – تولیدکننده تابلوهای برق : Home
Ashtikar.com
Shashank Ashtikar
Ashtimber.co.uk
Joinery | Ash Timber | Manchester | Rochdale | Middleton | Oldham
Ashtinhomes.com
Ashtin Homes of Arizona – Arizona home builder dedicated to building quality homes with high-end features
Ashtinsalon.com
Best Hair Salons Newport Beach | Hair Care Corona Del Mar
Ashtintransport.com
ashtintransport.com
Ashtisdale.pl
ASHLEYTISDALE.pl X ASHTISDALE.PL – Najlepsza polska strona po?wi?cona Ashley Michelle Tisdale! » AT POWRACA

Recently Updated Websites

Orlandoallstarseast.com 2 minutes 58 seconds ago.Universelenergy.com 3 minutes 5 seconds ago.Reachtec-aire.com 3 minutes 13 seconds ago.Nttianwei.com 4 minutes 36 seconds ago.Teatroilmaggioreverbania.com 4 minutes 42 seconds ago.Estimation-immobiliere-gratuite.net 4 minutes 42 seconds ago.Poolboxen.com 6 minutes 54 seconds ago.Bangalorenethralaya.com 7 minutes 10 seconds ago.Dianacarneiro.com 7 minutes 15 seconds ago.Zsxinyuan.com 7 minutes 23 seconds ago.Epicvb.com 7 minutes 34 seconds ago.Georgetowndc.com 7 minutes 43 seconds ago.Paramounthvac.com 9 minutes 13 seconds ago.Carpetcleaningmurfreesborotn.com 9 minutes 34 seconds ago.Garagedoorsmurrayky.com 9 minutes 43 seconds ago.Misegurodevida.info 9 minutes 51 seconds ago.Robotgenomes.com 10 minutes 3 seconds ago.Stephenhayes.net 10 minutes 8 seconds ago.Bkv-groep.nl 10 minutes 9 seconds ago.Krobarholdings.com 10 minutes 12 seconds ago.Binarypeople.net 10 minutes 14 seconds ago.Roczachary.com 10 minutes 17 seconds ago.Gardaservice.com 10 minutes 22 seconds ago.Pacificnwdentistry.com 10 minutes 27 seconds ago.Regaly.biz 10 minutes 29 seconds ago.700southstrand.com 10 minutes 32 seconds ago.Discipulado.com.br 10 minutes 46 seconds ago.Budmax-ceglowski.pl 10 minutes 53 seconds ago.Bitcoinaverage.com 10 minutes 58 seconds ago.Themodernvilla.com 10 minutes 59 seconds ago.