Ashtisdalefrance.net

Website Thumbnail
Checking...
Playing Pool Amercia | A Guide To Playing Pool Across The USA

Safety: Low trust score
Year Founded: 2011
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2015-12-08
Category: This site has not been categorized yet

A good pool table mover has the proper pool table moving equipment. The cost of moving a pool table can vary depending on certain conditions of the pool table


Domain summary

Domain label
ashtisdalefrance
Domain extension
net
Domain registered:
2011-11-13
Domain updated:
2015-11-02
Domain expires:
2016-11-13
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is ashtisdalefrance.net ranked relative to other sites:

Percentage of visits to ashtisdalefrance.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Ashtisdalefrance.net registered?
A: Ashtisdalefrance.net was registered 9 years, 2 weeks, 4 days, 4 hours, 58 minutes, 12 seconds ago on Sunday, November 13, 2011.
Q: When was the WHOIS for Ashtisdalefrance.net last updated?
A: The WHOIS entry was last updated 5 years, 4 weeks, 1 day, 4 hours, 58 minutes, 12 seconds ago on Monday, November 2, 2015.
Q: What are Ashtisdalefrance.net's nameservers?
A: DNS for Ashtisdalefrance.net is provided by the following nameservers:
  • ns1.1dollarwebhost.com
  • ns2.1dollarwebhost.com
Q: Who is the registrar for the Ashtisdalefrance.net domain?
A: The domain has been registered at .
Q: What is the traffic rank for Ashtisdalefrance.net?
A: Ashtisdalefrance.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Ashtisdalefrance.net each day?
A: Ashtisdalefrance.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Ashtisdalefrance.net resolve to?
A: Ashtisdalefrance.net resolves to the IPv4 address 204.15.252.120.
Q: In what country are Ashtisdalefrance.net servers located in?
A: Ashtisdalefrance.net has servers located in the United States.
Q: What webserver software does Ashtisdalefrance.net use?
A: Ashtisdalefrance.net is powered by webserver.
Q: Who hosts Ashtisdalefrance.net?
A: Ashtisdalefrance.net is hosted by NationalNet, Inc. in Nevada, Las Vegas, United States, 89102.
Q: How much is Ashtisdalefrance.net worth?
A: Ashtisdalefrance.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Ashtisdalefrance.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Ashtisdalefrance.net Free SEO Report

Website Inpage Analysis for Ashtisdalefrance.net

H1 Headings

1 :
  1. 10

H2 Headings

1 :
  1. 6

H3 Headings

1 :
  1. 7

H4 Headings

1 :
  1. 3

H5 Headings

1 :
  1. 0

H6 Headings

1 :
  1. 0

Total IFRAMEs

6 :

Total Images

5 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Ashtisdalefrance.net

clothplaying poolmovegoodcue ballimprovelocalendrulesaroundfindplayersclassicgamesninealwaysbackguaranteebecauselotturnyour4wayracktwo2ashadd a commentcomesecondcostcommentplayedyou couldsanmoving companyhandgocuethantrainingpocketsdonefirstgreatfactjustareapointextremelygamefunfreshwhiteexcellentlikelynumberlowest numberedmusttablesvisitjanuaryballsobjectgive youshotmayvariousplayingit8217stable moversyou canworlduseatingsan diegoneverthelessseteach playermythemgettrytheseverylookreconditionedputbeforemakepoollowestintohomeequipmentcoloradomanyindianapolisgottakerecreationalwhilehavebicycleplayyou needourwhichampnine ball2015 ashaddcalledcanlowest numbered ballshootinghisbeenbilliards gamepool tablesalltable movingbrandotherhoweverrepairinganyusehenottheir ownno1 pointchancemeansfoulfamilyhavingcouldend upcolored ballspurchaserestpool tabletoppool table moverseach0onefinecentergivefewpool table movingbilliard tableshassomeashadddon8217tfeetmightbarnumberedalsoskilledincludingthingtheirrightcompanyplayer1sopeopletabletimeseehadpocketbestwebsiteeverydiegonewlightstable moving companycertificationone mustdrivetheretheycoloredevensimilarprofessionalnumbered ballanotherballpopularmostordersuchhitlongmoversoutbilliard tableif youusuallymoresimply3railingchicagobrightnessbilliardsmovingcaromdoawesomeuphelpneedbilliardsimpleyouifpiecelightbutamongownshouldseveral

Longtail Keyword Density for Ashtisdalefrance.net

KeywordsOccurences
pool table moving7
ashadd a comment6
pool table movers5
table moving company3
lowest numbered ball3
pool table29
san diego14
pool tables7
table moving7
billiard table7
cue ball6
nine ball6
table movers5
billiard tables5
you need4
playing pool4
one must4
you can4
their own3
numbered ball3
billiards game3
end up3
each player3
lowest numbered3
1 point3
give you3
moving company3
2015 ashadd3
you could3
colored balls3
if you3
table60
pool52
you42
ball30
game26
billiards22
one22
can20
billiard19
have16
their16
not16
tables15
san15
there14
may14
diego14
also13
your13
great13
some13
very13
balls12
time12
they12
get11
but11
take11
which11
make10
could10
each10
it8217s9
player9
own9
all9
if9
must9
play9
need9
more9
out9
up9
so9
cue8
best8
people8
these8
he8
rules8
move8
guarantee7
fun7
playing7
any7
nine7
many7
moving7
our7
cost7
has7
long7
ashadd6
don8217t6
new6
go6
might6
excellent6
while6
them6
home6
help6
website6
my6
way6
comment6
end6
hand6
his6
than6
played6
most6
because6
popular6
visit5
other5
give5
even5
find5
few5
pockets5
movers5
use5
pocket5
just5
05
local5
chicago5
lights4
fresh4
light4
cloth4
family4
fact4
thing4
always4
see4
nevertheless4
shooting4
repairing4
had4
feet4
chance4
lowest4
14
look4
should4
24
railing4
come4
fine4
34
turn4
called4
drive4
hit4
bar4
center4
having4
numbered4
good4
before4
white4
object4
point4
colorado4
two4
carom4
number4
recreational3
bicycle3
us3
awesome3
amp3
do3
certification3
january3
improve3
into3
eating3
rack3
simple3
purchase3
similar3
got3
try3
every3
likely3
back3
classic3
rest3
done3
among3
world3
such3
players3
indianapolis3
right3
company3
another3
foul3
shot3
colored3
second3
usually3
order3
professional3
put3
means3
skilled3
reconditioned3
equipment3
43
various3
games3
first3
training3
lot3
extremely3
been3
set3
area3
brightness3
however3
including3
piece3
no3
around3
several3
simply3
top3
brand3

Who hosts Ashtisdalefrance.net?

Ashtisdalefrance.net Hosting Provider Information

Hosted IP Address:204.15.252.120
Hosted Hostname:spider.1dwh.net
Service Provider:NationalNet, Inc.
Hosted Country:United StatesUS
Location Latitude:36.1443
Location Longitude:-115.183
Webserver Software:Not Applicable

Is "NationalNet, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
NationalNet, Inc.
0.0153%

HTTP Header Analysis for Ashtisdalefrance.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 08 Dec 2015 22:09:46 GMT
Server: Apache
X-Powered-By: PHP/5.3.29
X-Pingback: http://ashtisdalefrance.net/xmlrpc.php
Content-Length: 38667
Connection: close
Content-Type: text/html; charset=UTF-8

Ashtisdalefrance.net Domain Nameserver Information

HostIP AddressCountry
ns1.1dollarwebhost.com 184.171.170.251United States United States
ns2.1dollarwebhost.com 204.15.248.150United States United States


Need to find out who hosts Ashtisdalefrance.net?


Domain Registration (WhoIs) information for Ashtisdalefrance.net

 Domain Name: ASHTISDALEFRANCE.NET
Registry Domain ID: 1687024851_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2016-11-04T04:24:02Z
Creation Date: 2011-11-13T22:31:45Z
Registry Expiry Date: 2017-11-13T22:31:45Z
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.1DOLLARWEBHOST.COM
Name Server: NS2.1DOLLARWEBHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-27T20:37:41Z

Websites with Similar Names

Ashtianilab.com
آزمایشگاه دکتر آشتیانی
Ashtiantablo.com
آشتیان تابلو – تولیدکننده تابلوهای برق : Home
Ashtikar.com
Shashank Ashtikar
Ashtimber.co.uk
Joinery | Ash Timber | Manchester | Rochdale | Middleton | Oldham
Ashtinhomes.com
Ashtin Homes of Arizona – Arizona home builder dedicated to building quality homes with high-end features
Ashtinsalon.com
Best Hair Salons Newport Beach | Hair Care Corona Del Mar
Ashtintransport.com
ashtintransport.com
Ashtisdale.pl
ASHLEYTISDALE.pl X ASHTISDALE.PL – Najlepsza polska strona po?wi?cona Ashley Michelle Tisdale! » AT POWRACA

Recently Updated Websites

Routine.company (3 seconds ago.)Yabotiyu7751.com (3 seconds ago.)Wooexperte.de (7 seconds ago.)Cryptogrowth.net (9 seconds ago.)Yahongtese.com (9 seconds ago.)Yabotiyu8253.com (11 seconds ago.)Yabotiyu6498.com (11 seconds ago.)Babesready.gifts (12 seconds ago.)Mallreport.com.tr (12 seconds ago.)Mfkozk.buzz (14 seconds ago.)Yhagency.com (15 seconds ago.)Yuexinchia.com (16 seconds ago.)Yabotiyu8046.com (17 seconds ago.)Jljwks.com (17 seconds ago.)Yabotiyu8314.com (20 seconds ago.)Yonaluky.com (21 seconds ago.)Yabotiyu6825.com (22 seconds ago.)Yabotiyu8021.com (24 seconds ago.)Yogasoo.com (24 seconds ago.)Muttahidoon.iq (25 seconds ago.)Yoshi-ki.com (25 seconds ago.)Zbodyshape.com (26 seconds ago.)Yabotiyu6053.com (28 seconds ago.)Unibase.club (28 seconds ago.)Yoducha.com (29 seconds ago.)Yourbestlifemassage.com (30 seconds ago.)Yabotiyu7715.com (32 seconds ago.)Yabotiyu8000.com (33 seconds ago.)Hq.link (34 seconds ago.)Yabotiyu8359.com (35 seconds ago.)

Recently Searched Keywords

start a conversation with a girl (6 seconds ago.)mobilodade articular (6 seconds ago.)artdian (7 seconds ago.)pegem ezberbozan coğrafya atlası pdf indir (8 seconds ago.)concepcion industrial corporation (14 seconds ago.)10-minute email (15 seconds ago.)mconcepcion (15 seconds ago.)concepcion carrier (16 seconds ago.)etixxsportsnutrition (16 seconds ago.)concepcion meaning (17 seconds ago.)longcount (17 seconds ago.)steuertipps (19 seconds ago.)tu vivienda y (19 seconds ago.)yabotiyu7882 (19 seconds ago.)smartsteuer hilft (19 seconds ago.)steuerformulare (20 seconds ago.)yatırım (20 seconds ago.)lb-stage (21 seconds ago.)abgabe (21 seconds ago.)myconcordia change password (22 seconds ago.)pure verschwendung unserer steuern (23 seconds ago.)yabotiyu6051 (23 seconds ago.)canvas2001 (23 seconds ago.)yatir forest wine (23 seconds ago.)mobilodade social (23 seconds ago.)vorsorgeaufwendungen (23 seconds ago.)vom staat (24 seconds ago.)jetzt loslegen! (24 seconds ago.)cortez shoes (24 seconds ago.)ayyavazhi (24 seconds ago.)