Italian Restaurants in the UK | ASK Italian Restaurants

Safety: Low trust score
Year Founded: 2010
Global Traffic Rank: 374,758
Estimated Worth: $33,480

ASK Italian is a family of restaurants across the UK. Eat like an Italian with pizza and pasta dishes in quintessentially Italian interiors.



Domain summary

Last updated
2021-09-07
Domain label
askitalian
Domain extension
co.uk
Domain registered:
2010-02-24
Domain updated:
2015-07-22
Domain expires:
0000-00-00
Global Traffic Rank
374,758
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$33,480
Estimated daily income
$62
Estimated monthly income
$1,886

Frequently Asked Questions (FAQ)

Q: When was Askitalian.co.uk registered?
A: Askitalian.co.uk was registered 11 years, 7 months, 3 days, 3 hours, 34 minutes, 8 seconds ago on Wednesday, February 24, 2010.
Q: When was the WHOIS for Askitalian.co.uk last updated?
A: The WHOIS entry was last updated 6 years, 2 months, 5 days, 3 hours, 34 minutes, 8 seconds ago on Wednesday, July 22, 2015.
Q: What are Askitalian.co.uk's nameservers?
A: DNS for Askitalian.co.uk is provided by the following nameservers:
  • ns0.phase8.net
  • ns1.phase8.net
  • ns2.phase8.net
Q: Who is the registrar for the Askitalian.co.uk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Askitalian.co.uk?
A: Askitalian.co.uk ranks 374,758 globally on Alexa. Askitalian.co.uk has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Askitalian.co.uk each day?
A: Askitalian.co.uk receives approximately 5,526 visitors and 22,104 page impressions per day.
Q: What IP address does Askitalian.co.uk resolve to?
A: Askitalian.co.uk resolves to the IPv4 address 164.138.227.87.
Q: In what country are Askitalian.co.uk servers located in?
A: Askitalian.co.uk has servers located in the United Kingdom.
Q: What webserver software does Askitalian.co.uk use?
A: Askitalian.co.uk is powered by webserver.
Q: Who hosts Askitalian.co.uk?
A: Askitalian.co.uk is hosted by Sleek Networks Ltd in England, Kent, United Kingdom, Me10 4e.
Q: How much is Askitalian.co.uk worth?
A: Askitalian.co.uk has an estimated worth of $33,480. An average daily income of approximately $62, which is roughly $1,886 per month.

Askitalian.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Askitalian.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Askitalian.co.uk

H1 Headings

0 :

H2 Headings

4 :
  1. INDOORS OR OUTDOORS
  2. al fresco eating
  3. Point Me in theright direction
  4. FROM OUR KITCHEN TO YOUR home

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

12 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-35755607-6

Links - Internal

35:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Askitalian.co.uk

yourwouldthank you welcomewellanytime you canfamilyname lastaskfirst name lastour privacy policypolicy hereupcan unsubscribeask italian familysoonourmoreyour askask italianmenureadread our privacyanytime youour privacysignlastask perksemaillike to receivetakeawaypolicycan readtouch soonnbspcontactwould likehomesign uprestaurantsunderstandlondon 8211canask perks emailslocationsoutthank youcan read ouryouyou welcomereceive ask perksread ourfindfirstopenunsubscribe at anytimeitalian family wellyou canpleaseemailsitalian familyusprivacy policyherethankitalianlondonyou can readprivacy policy herename last namerestaurantnameprivacy0touchperksemails i understandour restaurantsreceive askfamily wellwelcomeunsubscribelikeperks emailsfirst nameanytimecontact usreceivelast namebook

Longtail Keyword Density for Askitalian.co.uk

KeywordsOccurences
receive ask perks5
thank you welcome3
ask italian family3
italian family well3
first name last3
name last name3
like to receive3
ask perks emails3
emails i understand3
unsubscribe at anytime3
anytime you can3
you can read3
can read our3
read our privacy3
our privacy policy3
privacy policy here3
ask perks9
sign up6
ask italian5
london 82115
receive ask5
privacy policy4
you can4
thank you3
anytime you3
our restaurants3
your ask3
policy here3
our privacy3
read our3
can read3
can unsubscribe3
you welcome3
perks emails3
contact us3
last name3
name last3
first name3
touch soon3
family well3
italian family3
would like3
ask18
your16
you13
takeaway11
our10
can9
menu9
perks9
up7
nbsp7
06
sign6
italian6
open6
name6
policy5
receive5
london5
us5
more5
please5
privacy4
restaurants4
here4
find4
read4
contact4
like3
out3
thank3
welcome3
family3
restaurant3
well3
touch3
soon3
book3
understand3
first3
last3
email3
locations3
would3
anytime3
unsubscribe3
home3
emails3

Who hosts Askitalian.co.uk?

Askitalian.co.uk Hosting Provider Information

Hosted IP Address:164.138.227.87
Hosted Hostname:no-dns-yet.sleek.net
Service Provider:Sleek Networks Ltd
Hosted Country:United KingdomGB
Location Latitude:51.25
Location Longitude:0.75
Webserver Software:Not Applicable

Is "Sleek Networks Ltd" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Sleek Networks Ltd
0.0000%

HTTP Header Analysis for Askitalian.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Date: Tue, 07 Sep 2021 08:48:08 GMT
Server: nginx
X-Powered-By: PHP/7.3.30
Last-Modified: 1631003074 GMT
Link:; rel=shortlink
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
Content-Encoding: gzip
Vary: Accept-Encoding
X-Cache: Hit from cloudfront
Via: 1.1 f9cbcaddb963320cc8ddff3e446eec07.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: LHR62-C4
X-Amz-Cf-Id: -M6KpE6hoXx4xewSu2y4ds19-mT1JcfpNrDEGrqY_L-T7sp06qm-Kg==
Age: 1560

Askitalian.co.uk Domain Nameserver Information

HostIP AddressCountry
ns0.phase8.net 81.88.63.114
ns1.phase8.net 85.233.160.68
ns2.phase8.net 91.186.2.48


Need to find out who hosts Askitalian.co.uk?


Domain Registration (WhoIs) information for Askitalian.co.uk

 Domain name:
askitalian.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 18-Sep-2020

Registrar:
Namesco Limited [Tag = NAMESCO]
URL: http://www.names.co.uk

Relevant dates:
Registered on: 24-Feb-2010
Expiry date: 24-Feb-2022
Last updated: 04-Jan-2021

Registration status:
Registered until expiry date.

Name servers:
ns0.phase8.net
ns1.phase8.net
ns2.phase8.net

WHOIS lookup made at 10:14:11 07-Sep-2021

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2021.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Askit-services.com
5分28官网-首页
Askit.biz
Domain Name Check & Register, Free Trusted SSL Certificates for Site & Hosting
Askit.com.hk
Comprehensive IT x HR Solutions | ASK IT Limited
Askit.com.mx
askit | Preguntalo Todo
Askit.online
Digital transformation strategy consultancy | Ask IT Online
Askit.ru
Академия Специальных Курсов по Информационным Технологиям, Санкт-Петербург

Recently Updated Websites

Faithpaint.com (8 seconds ago.)Vpro.by (9 seconds ago.)Yourlifeatkroger.com (11 seconds ago.)Outreachseminar.com (18 seconds ago.)Zerowastecooperative.com (18 seconds ago.)Sweatsocietyasia.com (23 seconds ago.)Mobilyamutfak.net (26 seconds ago.)Dmwfashiondesign.com (28 seconds ago.)Minisierra.net (29 seconds ago.)Competitionscentral.com (31 seconds ago.)Primewashingbd.com (38 seconds ago.)Vgulp.com (39 seconds ago.)Universitygenesisofdecatur.com (40 seconds ago.)Technofastconsulting.com (42 seconds ago.)Roccogio.com (47 seconds ago.)Gapsasweb.com (49 seconds ago.)Shehrebanumerchantmd.com (54 seconds ago.)Whitehousechild.org (56 seconds ago.)Sevenjournals.com (56 seconds ago.)Ecclescontracting.com (59 seconds ago.)Jurtenwerk.com (1 minute 1 second ago.)Win.football (1 minute 2 seconds ago.)Aoabet4058.com (1 minute 3 seconds ago.)Goldfish.games (1 minute 5 seconds ago.)Jademountainbotanicals.com (1 minute 6 seconds ago.)Cirquelondon.ml (1 minute 11 seconds ago.)Eloquagooglesheetsaddon.com (1 minute 12 seconds ago.)Hjorturjohannsson.com (1 minute 12 seconds ago.)Oahuan.us (1 minute 15 seconds ago.)Lizhenlong.com (1 minute 17 seconds ago.)

Recently Searched Keywords

rangasthalam (1 second ago.)expressaonoticias (1 second ago.)log in to check your private messages (1 second ago.)rake pokerstars.it (1 second ago.)strathspey (1 second ago.)acer liquid jade z (5 seconds ago.)frangipane recipe (5 seconds ago.)netiquette poster (5 seconds ago.)url utilityadvertisement (6 seconds ago.)виниловая пластинка. stevie wonder  (7 seconds ago.)ix encuentro. barcelona, 2013 (8 seconds ago.)gw-go-price-wrap span (9 seconds ago.)κοινωνία (9 seconds ago.)studybuddy.se (10 seconds ago.)kissanime apk (10 seconds ago.)u01a0-01a1 u01af-01b0 u1ea0-1ef9 (11 seconds ago.)especificaciones de motor (11 seconds ago.)新西兰 (11 seconds ago.)sukie kim (12 seconds ago.)розовый фон скачать (12 seconds ago.)psichologija (16 seconds ago.)huayra r (19 seconds ago.)foreign exchange market (20 seconds ago.)each of them meaning (21 seconds ago.)leia mais livros uol (21 seconds ago.)2021 kurslarlinktargetblanktypewixdatapageidcxtbmtargetselftypepagelinkpagenametyt ayt (22 seconds ago.)may 1, 2012 (24 seconds ago.)nutrient deficiency (25 seconds ago.)129,395 tea bags (25 seconds ago.)hellip marketing (26 seconds ago.)