Asser84.fr

Website Thumbnail
Checking...
Présentation | ASSER

Safety: Low trust score
Year Founded: 2006
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-31
Category: This site has not been categorized yet

Le club - Présentation - Depuis 45 ans, l'approche sportive, les contenus d’activités, les valeurs de l’omnisport, de l’éducation populaire, de la vie associative et du bénévolat son...


Domain summary

Domain label
asser84
Domain extension
fr
Domain registered:
2006-06-28
Domain updated:
2019-07-17
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is asser84.fr ranked relative to other sites:

Percentage of visits to asser84.fr from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Asser84.fr registered?
A: Asser84.fr was registered 14 years, 5 months, 1 day, 16 hours, 25 minutes, 25 seconds ago on Wednesday, June 28, 2006.
Q: When was the WHOIS for Asser84.fr last updated?
A: The WHOIS entry was last updated 1 year, 4 months, 1 week, 5 days, 16 hours, 25 minutes, 25 seconds ago on Wednesday, July 17, 2019.
Q: What are Asser84.fr's nameservers?
A: DNS for Asser84.fr is provided by the following nameservers:
  • ns0.online.net
  • ns1.online.net
Q: Who is the registrar for the Asser84.fr domain?
A: The domain has been registered at AFNIC.
Q: What is the traffic rank for Asser84.fr?
A: Asser84.fr has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Asser84.fr each day?
A: Asser84.fr receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Asser84.fr resolve to?
A: Asser84.fr resolves to the IPv4 address 62.210.16.61.
Q: In what country are Asser84.fr servers located in?
A: Asser84.fr has servers located in the France.
Q: What webserver software does Asser84.fr use?
A: Asser84.fr is powered by Nginx webserver.
Q: Who hosts Asser84.fr?
A: Asser84.fr is hosted by ONLINE S.A.S. in France.
Q: How much is Asser84.fr worth?
A: Asser84.fr has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Asser84.fr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Asser84.fr Free SEO Report

Website Inpage Analysis for Asser84.fr

H1 Headings

0 :

H2 Headings

1 :
  1. Depuis 45 ans, l'approche sportive, les contenus d’activités, les valeurs de l’omnisport, de l’éducation populaire, de la vie associative et du bénévolat sont au cœur du projet associatif de l’ASSER:

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

31 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-20401914-16

Links - Internal

38:
  1. http://asser84.fr/page/485344-presentation
    http://asser84.fr/page/485344-presentation
  2. Asser84 Présentation
    http://asser84.fr/page/485344-presentation
  3. Asser84 REGLEMENT ASSOCIATIF
    http://asser84.fr/page/619049-reglement-associatif
  4. Asser84 Maison Sport Santé
    http://asser84.fr/page/910742-maison-sport-sante
  5. Asser84 ASSER
    http://asser84.fr/page/485344-presentation
  6. Asser84 Le club ▴▾
    http://asser84.fr/page/485344-presentation
  7. Asser84 LES ACTIVITES ▴▾
    http://asser84.fr/page/619048-conditions
  8. Asser84 CONDITIONS
    http://asser84.fr/page/619048-conditions
  9. Asser84 3/4 ans
    http://asser84.fr/page/618820-3-4-ans
  10. Asser84 5/7 ans
    http://asser84.fr/page/618821-5-7-ans
  11. Asser84 8/11 ans
    http://asser84.fr/page/618822-8-11-ans
  12. Asser84 12/15 ans
    http://asser84.fr/page/618823-12-15-ans
  13. Asser84 FAMILLE
    http://asser84.fr/page/618824-famille
  14. Asser84 ADULTES
    http://asser84.fr/page/618825-adultes
  15. Asser84 SENIORS
    http://asser84.fr/page/618826-seniors
  16. Asser84 SPORT SUR ORDONNANCE
    http://asser84.fr/page/618827-sport-sur-ordonnance
  17. Asser84 REUSSITE EDUCATIVE
    http://asser84.fr/page/618828-reussite-educative
  18. Asser84 Tarifs
    http://asser84.fr/page/485350-tarifs
  19. Asser84 PLANNINGS DES SECTIONS
    http://asser84.fr/page/714459-plannings-des-sections
  20. Asser84 STAGES ET SEJOURS SPORTIFS ▴▾
    http://asser84.fr/page/699393-stages-sportifs
  21. Asser84 STAGES SPORTIFS
    http://asser84.fr/page/699393-stages-sportifs
  22. Asser84 SEJOURS SPORTIF
    http://asser84.fr/page/1122767-sejours-sportif
  23. Asser84 Infos utiles ▴▾
    http://asser84.fr/page/485352-acces-et-contact
  24. Asser84 Accès et contact
    http://asser84.fr/page/485352-acces-et-contact
  25. Asser84 Horaires
    http://asser84.fr/page/485349-horaires
  26. Asser84 Adhésions en ligne
    http://asser84.fr/page/485351-adhesions-en-ligne
  27. Asser84 FICHE INSCRIPTION
    http://asser84.fr/page/699360-fiche-inscription
  28. Asser84 AGENDA ▴▾
    http://asser84.fr/page/485354-agenda
  29. http://asser84.fr/
    http://asser84.fr/
  30. Asser84 Se connecter
    http://asser84.fr/membres/connexion?redirect=%2Fpage%2F485344-presentation
  31. https://www.asser84.fr/page/-
    https://www.asser84.fr/page/-
  32. https://www.asser84.fr
    https://www.asser84.fr
  33. Asser84 Plan du site
    http://asser84.fr/infos/plan/ 115023
  34. Asser84 Licences
    http://asser84.fr/infos/licences
  35. Asser84 Mentions légales
    http://asser84.fr/infos/mentions-legales
  36. Asser84 CGUV
    http://asser84.fr/infos/cguv
  37. Asser84 Se connecter
    https://www.asser84.fr/membres/connexion?redirect=%2Fpage%2F485344-presentation
  38. Asser84 En savoir plus
    http://asser84.fr/infos/cookie

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Asser84.fr

du1151pxdivfondifrenabletemplatenavbartemplatenavwrapper templatenav templatesubnavwrapperne pas modifiermodifier les pucesmaxwidth 1150pxtemplatenavsubbarwrapper templatenavsubbarwrappertemplatebreadcrumb breadcrumbitemsbackgroundcolortemplatenavwrapperbuttoninterval1150pxtemplatepagereglement associatiftemplatenavwrapper templatenav uletne pasvotrenoteventcolor pour nesejourshauteur dudu contenuul li0templatepage prendtemplatenavwrapperbeforeh2du hauttemplatenavchargementwindowheighttemplatebreadcrumbcolortemplatesubnavwrapper ulhauteurgridwrapper box buttondiycontainerfalsetemplateheadereventcountdownwrapperbox buttondiycontainer buttondiywrapperliactivegridwrapperneaccordionblocagemenutextmodifier lestemplatepageheightbout de 1agendawrappertemplateheaderwrapperpaddingwindowsettimeoutfunctionpas modifierprsentation reglement associatiflicouleur dumenu templatenavwrapper templatenavmedia minwidth 1151pxifrenable windowsettimeoutfunctionsitemaison sportdansdeb515borderradius 5pxbuttonwhiteblueactiveunnoteventcolor pourau curcontenuassociatif maisonborder 0esttemplatenavcontainerpositioneventwrapper eventpicture eventcountdownwrapperaccordion accordioncontentaccordioncolorvar316bf2autexturehaut de pagestagesmaison sport santbuttonwhitebluehover3buttondiycontainer buttondiywrapperpasagendalisttemplatenavwrapper templatenavaccordion accordioncontentaccordioncolor accordiontitlewrappersursiagendawrapper agendalisttemplatenav templatesubnavwrappertextepuces de lagendaboxdatatypebuttonaccordioncontentaccordioncolorseconde ifrenable windowsettimeoutfunctionassociatifmedia minwidtheventpicture eventcountdownwrapperhauteur du menuprendreglementtemplatenav ul lipxtemplatesubnavwrapperet duabsolute leftaccspucesmargin 0important border2box buttondiycontainerpas modifier lesnoteventcolordans lewindowbuttondiycontainerboxes boxdatatypebutton buttondiycontainereventpicturemediaabsoluteminwidthbordercolormedia maxwidthcouleurdialogdotwrappereventwrapperdivnotagendawrapper agendaeventprsentation reglementimgcacheans0 marginmedia maxwidth 1150pxsi ledesbuttondombuttondiywrapperpour ne paspagepropdisabledboxespadding 0 marginsportifstemplatenavwrapper templatenavwrapperbefore1 seconde ifrenableprsentationmargin0 margin 0importantlesilreglement associatif maisonboxes boxdatatypebuttonthisdatamultisubmitprotectionboutdblocage au boutminwidth 1151pxles pagesheightmaxaccordiontitlewrappergridwrapper boxpourtople menu5pxquielsebody0pxlefttemplatenav ul0important borderheightdivnotagendawrapperfamillebackgroundtemplatenavcontainerheightpour nepadding 0du menuagendaeventle1 secondepagessecondehauttruesportblocfonctionboxdatatypebutton buttondiycontainer buttondiywrapperle hautmenu templatenavwrappereventwrapper eventpicturemenu simargin 0importantsport santpage templateheaderwrapperprend la hauteurboxdatatypebutton buttondiycontainerfunctionsportiveslogoseconde ifrenablesantdblocage0important border 0modifierreturnau bout1maxwidthborderradiusassociatif maison sport0importantcurposition absolute lefticonsbreadcrumbitemsf7ca18ulposition absolutebackgroundimagetemplatenavsubbarwrapperfentretemplateheaderwrapper templateheaderlagendadiyboxles pucesmaisontemplatesubnavwrapper ul liaccordioncontentaccordioncolor accordiontitlewrapperborderbackgroundcolor f7ca18texture dudblocage au

Longtail Keyword Density for Asser84.fr

KeywordsOccurences
templatenavwrapper templatenav ul8
haut de page7
templatenav ul li5
1 seconde ifrenable4
reglement associatif maison4
associatif maison sport4
maison sport sant4
dblocage au bout4
bout de 14
prsentation reglement associatif4
seconde ifrenable windowsettimeoutfunction4
pour ne pas4
eventwrapper eventpicture eventcountdownwrapper4
templatenavwrapper templatenav templatesubnavwrapper3
padding 0 margin3
0 margin 0important3
margin 0important border3
0important border 03
position absolute left3
accordion accordioncontentaccordioncolor accordiontitlewrapper3
hauteur du menu3
menu templatenavwrapper templatenav3
media max-width 1150px3
media min-width 1151px3
box buttondiycontainer buttondiywrapper3
gridwrapper box buttondiycontainer3
boxdata-typebutton buttondiycontainer buttondiywrapper3
boxes boxdata-typebutton buttondiycontainer3
puces de lagenda3
modifier les puces3
pas modifier les3
ne pas modifier3
noteventcolor pour ne3
templatesubnavwrapper ul li3
prend la hauteur3
templatenavwrapper templatenav14
du menu13
ul li9
templatenav ul8
hauteur du6
agendawrapper agendalist6
buttondiycontainer buttondiywrapper6
templatesubnavwrapper ul5
eventwrapper eventpicture5
couleur du4
associatif maison4
dblocage au4
sport sant4
maison sport4
padding 04
reglement associatif4
prsentation reglement4
le menu4
le haut4
au bout4
seconde ifrenable4
1 seconde4
divnotagendawrapper agendaevent4
ifrenable windowsettimeoutfunction4
ne pas4
pour ne4
eventpicture eventcountdownwrapper4
et du3
templatenav templatesubnavwrapper3
au cur3
border 03
0important border3
border-radius 5px3
margin 0important3
les pages3
menu si3
0 margin3
absolute left3
position absolute3
du contenu3
si le3
menu templatenavwrapper3
gridwrapper box3
accordion accordioncontentaccordioncolor3
accordioncontentaccordioncolor accordiontitlewrapper3
templatebreadcrumb breadcrumbitems3
templatenavsubbarwrapper templatenavsubbarwrapper3
noteventcolor pour3
pas modifier3
modifier les3
les puces3
boxes boxdata-typebutton3
boxdata-typebutton buttondiycontainer3
box buttondiycontainer3
dans le3
media min-width3
min-width 1151px3
templatenavwrapper templatenavwrapperbefore3
background-color f7ca183
templateheaderwrapper templateheader3
media max-width3
max-width 1150px3
texture du3
du haut3
page templateheaderwrapper3
templatepage prend3
du35
et18
menu18
templatenavwrapper18
background-color17
var16
les16
des15
014
ul14
templatenav14
le13
templatesubnavwrapper11
function11
page11
agendawrapper10
pour10
templatenavsubbarwrapper9
hauteur9
li9
ans9
return9
color9
true8
au8
border-color8
pas8
haut7
ne7
boxes7
eventwrapper7
height7
templatepage7
est7
templateheaderwrapper6
padding6
buttondom6
si6
else6
sport6
dans6
false6
position6
bloc6
media6
couleur6
buttondiywrapper6
agendaevent6
agendalist6
buttondiycontainer6
sur5
316bf25
site5
15
sant5
associatif5
eventpicture5
absolute5
templatenavcontainerheight5
heightmax5
reglement4
prsentation4
maison4
divnotagendawrapper4
pages4
top4
thisdatamulti-submit-protection4
blocage4
text4
buttoninterval4
propdisabled4
px4
dblocage4
bout4
24
seconde4
ifrenable4
windowsettimeoutfunction4
34
qui4
icons4
un4
eventcountdownwrapper4
max-width4
logo4
div4
box4
templatenavbar4
f7ca184
border4
1151px3
templatenavwrapperbefore3
lagenda3
cache3
templateheader3
left3
fonction3
1150px3
il3
puces3
min-width3
cur3
margin3
0important3
deb5153
boxdata-typebutton3
votre3
body3
diy3
templatepageheight3
templatenavcontainer3
prend3
windowheight3
fentre3
liactive3
chargement3
fond3
stages3
0px3
img3
border-radius3
5px3
texte3
buttonwhitebluehover3
buttonwhiteblueactive3
background3
gridwrapper3
background-image3
dialogdotwrapper3
famille3
sejours3
modifier3
sportifs3
accs3
sportives3
breadcrumbitems3
templatebreadcrumb3
h23
accordiontitlewrapper3
accordioncontentaccordioncolor3
accordion3
noteventcolor3
texture3
contenu3
window3

Who hosts Asser84.fr?

Asser84.fr Hosting Provider Information

Hosted IP Address:62.210.16.61
Hosted Hostname:pf-lb-1.online.net
Service Provider:ONLINE S.A.S.
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:nginx

Is "ONLINE S.A.S." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
ONLINE S.A.S.
0.1638%

HTTP Header Analysis for Asser84.fr

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Sat, 31 Oct 2020 00:51:10 GMT
Content-Type: text/html; charset=iso-8859-1
Content-Length: 311
Connection: keep-alive
Location: https://www.asser84.fr/

Asser84.fr Domain Nameserver Information

HostIP AddressCountry
ns0.online.net 195.154.228.249
ns1.online.net 62.210.16.9


Need to find out who hosts Asser84.fr?


Domain Registration (WhoIs) information for Asser84.fr

 %%
%% This is the AFNIC Whois server.
%%
%% complete date format : YYYY-MM-DDThh:mm:ssZ
%% short date format : DD/MM
%% version : FRNIC-2.5
%%
%% Rights restricted by copyright.
%% See https://www.afnic.fr/en/products-and-services/services/whois/whois-special-notice/
%%
%% Use '-h' option to obtain more information about this service.
%%
%% [64.227.39.39 REQUEST] >> asser84.fr
%%
%% RL Net [##########] - RL IP [#########.]
%%

domain: asser84.fr
status: ACTIVE
hold: NO
holder-c: M3560-FRNIC
admin-c: M3560-FRNIC
tech-c: O95-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL3159-FRNIC
registrar: ONLINE SAS
Expiry Date: 2022-06-28T08:28:54Z
created: 2006-06-28T08:28:54Z
last-update: 2019-07-17T14:45:39Z
source: FRNIC

ns-list: NSL3159-FRNIC
nserver: ns0.online.net
nserver: ns1.online.net
source: FRNIC

registrar: ONLINE SAS
type: Isp Option 1
address: 8 Rue de la Ville l'Evêque
address: 75008 PARIS
country: FR
phone: 01 84 13 00 69
fax-no: +33 1 73 50 29 01
e-mail: Login to show email
https://www.bookmyname.com/nom_de_domaine/tarif_nom_de_domaine.html
anonymous: NO
registered: 1999-04-01T12:00:00Z
source: FRNIC

nic-hdl: M3560-FRNIC
type: ORGANIZATION
contact: MARCO
address: 546 chemin des Ramieres
address: 84700 sorgues
country: FR
phone: +33.432443092
e-mail: Login to show email
ONLINE SAS
changed: 2019-07-17T10:21:04Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: M3560-FRNIC
type: ORGANIZATION
contact: MARCO
address: 546 chemin des Ramieres
address: 84700 sorgues
country: FR
phone: +33.432443092
e-mail: Login to show email
ONLINE SAS
changed: 2019-07-17T10:21:04Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: O95-FRNIC
type: ORGANIZATION
contact: ONLINE
address: 8 rue de la ville l'eveque
address: 75008 PARIS
country: FR
phone: +33.184130000
fax-no: +33.173502901
e-mail: Login to show email
ONLINE SAS
changed: 2019-06-18T17:01:13Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

Websites with Similar Names

Asser.nl
T.M.C. Asser Instituut
Asser84.fr
Présentation | ASSER
Asseram.com
asseram.com This domain has expired!
Asseransi.com
ASSERANSI
Asserattours.com
As Serat Tours | The Path That Leads
Asserb.com
account suspended | siteberry.net
Asserbiz.events
Serviços de Marketing: Acreditação Eletrónica, SMS, Avaliação de satisfação Asserbiz Serviços de Marketing para Clientes e Eventos
Assercamcm.com.br
ASSERCAM - Associação dos Servidores Municipais de Campo Mourão
Assercancanarias.com
AssercanCanarias – Sistemas de telecomunicaciones inalámbricos

Recently Updated Websites

Mikrogaz.com 2 seconds ago.Mascheregraduate.it 3 seconds ago.Salon-damario.de 5 seconds ago.Y-ryadom.ru 5 seconds ago.Kaufmansdeadpool.com 6 seconds ago.Jardinlomasaltas.mx 9 seconds ago.Genealor.net 9 seconds ago.Like.in.th 10 seconds ago.Oaglawfirm.com 11 seconds ago.Wanyama.com 11 seconds ago.Tanninisetosi.it 12 seconds ago.Fsfsf.com 12 seconds ago.Aisshowerdoors.com 12 seconds ago.Cellshop.ca 12 seconds ago.Taradanova.pro 15 seconds ago.Smell-a-rat.com 16 seconds ago.Abadiabaiaoimoveis.com.br 17 seconds ago.Tj-store.com 18 seconds ago.Theguidestore.com 19 seconds ago.Hagopianlawoffice.com 19 seconds ago.Actchem.com 20 seconds ago.Holidayloan.co.uk 23 seconds ago.Gorod42622.ru 23 seconds ago.Bryckie.com 24 seconds ago.Mystakingwallet.com 25 seconds ago.Bazevian.com 27 seconds ago.Ramadaplazamardin.com 28 seconds ago.Ombra-market.ru 28 seconds ago.Voyageconciergeservices.com 30 seconds ago.Elbabalawyers.com 31 seconds ago.