Accueil | RIVAGE

Safety: Low trust score
Year Founded: 2018
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-28
Category: This site has not been categorized yet

Accueil - Accueil -   lire - Les états généraux de la bioéthique se penchent, entre autre, sur la fin de vie - lire...


Domain summary

Domain label
association-rivage
Domain extension
net
Domain registered:
2018-04-17
Domain updated:
2020-04-01
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is association-rivage.net ranked relative to other sites:

Percentage of visits to association-rivage.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Association-rivage.net registered?
A: Association-rivage.net was registered 2 years, 9 months, 5 days, 14 hours, 45 minutes, 5 seconds ago on Tuesday, April 17, 2018.
Q: When was the WHOIS for Association-rivage.net last updated?
A: The WHOIS entry was last updated 9 months, 3 weeks, 14 hours, 45 minutes, 5 seconds ago on Wednesday, April 1, 2020.
Q: What are Association-rivage.net's nameservers?
A: DNS for Association-rivage.net is provided by the following nameservers:
  • dns100.ovh.net
  • ns100.ovh.net
Q: Who is the registrar for the Association-rivage.net domain?
A: The domain has been registered at OVH sas.
Q: What is the traffic rank for Association-rivage.net?
A: Association-rivage.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Association-rivage.net each day?
A: Association-rivage.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Association-rivage.net resolve to?
A: Association-rivage.net resolves to the IPv4 address 213.186.33.5.
Q: In what country are Association-rivage.net servers located in?
A: Association-rivage.net has servers located in the France.
Q: What webserver software does Association-rivage.net use?
A: Association-rivage.net is powered by webserver.
Q: Who hosts Association-rivage.net?
A: Association-rivage.net is hosted by OVH SAS in France.
Q: How much is Association-rivage.net worth?
A: Association-rivage.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Association-rivage.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Association-rivage.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Association-rivage.net

H1 Headings

0 :

H2 Headings

5 :
  1. Implantation géographique
  2. Accompagnement de la maladie grave
  3. Accompagnement de la fin de vie
  4. Accompagnement du deuil
  5. Accompagnement du grand âge

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

42 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-20401914-16

Links - Internal

46:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Association-rivage.net

1 secondeviepagesffffffles puceseventcountdownwrappertemplatepage prenddu120px height 240pxifrenablele240pxpaddingaccordion accordioncontentaccordioncolor accordiontitlewrapperfunctionaccompagnementpourtop 120px heightfalseheight 60pxtrue120px heightul lidisplaytemplatenavminwidthdesvardans1 seconde ifrenablemediahauttemplatenav ul libuttondom4templatenav ulboxesbox buttondiycontainer buttondiywrapper60px paddingleft 50 topminwidth 1151pxheight 60px paddingd039accompagnement10pxfin de viehauteurgridwrappertemplatebreadcrumb breadcrumbitemsleft 0 topdiyetprendabsolutepropdisabledboxdatatypebuttonmodifier les pucesifrenable windowsettimeoutfunctionpagetemplatenavwrapperbeforegetemplatenavwrapper templatenav ulfintemplatesubnavwrapper ulquih2positionbreadcrumbitemshauteur dublocageurlhttpswebassoconnectfrcprodcdnendpointsoftwareazureedgenetlegacycommonimagelayoutpublictexturesblankpngboxtemplatenavwrapper templatenavmedia minwidth 1151pxtemplateheaderwrapper templateheader templateheaderblockcontainerbuttondiycontainer buttondiywrappermargin 0importantsecondesuragendalistpour ne paslogoabsolute left 0du deuilmenu si0important border 0pucesbordertemplatenavsubbarwrapper templatenavsubbarwrappereventpictureimportanteventpicture eventcountdownwrappertemplatebreadcrumbpas modifier lesboxes boxdatatypebuttondblocage au0 accompagnementsontagendawrapper agendalistmaladie gravebackgroundimageboxdatatypebutton buttondiycontainerformationpxtextefonctionseconde ifrenable windowsettimeoutfunctiontemplatepageheightsibloc templateheaderwrapper templateheaderfentreildu menumenu templatenavwrappertemplateheaderwrapperpastextbackgroundcolor ffffffposition absolute leftleft 50haut de pagedblocagelesaccordiontitlewrapperbodygraveagendaeventles pagesdu haut0 margintop 120pxborderradiusbuttonwhitebluehover60px padding 0divnotagendawrappergridwrapper box buttondiycontainerdu contenucontenuwidth120pxcachebnvolestemplateheaderwrapper templateheadertemplatepageestdiv2border 0buttonintervaleventwrapper eventpicturebnvoletemplatenavcontainerheightabsolute left 50si leulle menu5media maxwidthl039association0importanttemplateheader templateheaderblockcontainerpage templateheaderwrapperaccordioncontentaccordioncolorpas modifierblocthisdatamultisubmitprotectionmaxwidth 1150pxlimodifier leseventwrapper eventpicture eventcountdownwrapperwindow0 top0important bordertemplatenavbarmargin 0important bordervotreboutbordercolortransparentdblocage au boutbox buttondiycontainerformdivnotagendawrapper agendaevent240px padding 03windowsettimeoutfunctionbuttondiywrappermaladiedu grandaccordioncontentaccordioncolor accordiontitlewrappertexture duheight 240px paddingcouleur dunosboxes boxdatatypebutton buttondiycontainerwindowheightpadding 0 margintemplateheaderblockcontainerabsolute lefttemplatenavwrapper templatenavwrapperbeforeimplantationaccordionnoteventcolor pouragendawrapperbackgroundcolorautemplateheader0left20pxlagendagrand1maxwidthbackgroundimage urlhttpswebassoconnectfrcprodcdnendpointsoftwareazureedgenetlegacycommonimagelayoutpublictexturesblankpngposition absoluteliactivetoptemplatenavwrapperborderradius 5px0 margin 0importanttemplatenavsubbarwrappertexturebout de 1textalignimgnenotrepadding 0uneiconstemplatenavcontainerpossiblecolor 316bf260pxgrand geau boutnoteventcolor pour ne316bf2chargementeventwrapperelsepour nemargindans leaccordion accordioncontentaccordioncolor50 topleft 05pxrivagedu grand genoteventcolorse1150pxcolorboxdatatypebutton buttondiycontainer buttondiywrapperdeuilmenu templatenavwrapper templatenavhauteur du menufondne pas modifiergridwrapper boxseconde ifrenable1151pxnoncouleurprend la hauteurbloc templateheaderwrappermedia minwidthdialogdotwrapperne pasreturnmodifiermedia maxwidth 1150px240px paddingtemplatesubnavwrapper ul limenubuttondiycontainertemplatesubnavwrappersitetoujoursunbuttonwhiteblueactivele hautheight 240pxheightmaxpuces de lagendaheightborder 0 accompagnement

Longtail Keyword Density for Association-rivage.net

KeywordsOccurences
padding 0 margin18
0 margin 0important18
margin 0important border18
0important border 018
position absolute left18
240px padding 013
height 240px padding13
left 0 top9
absolute left 09
templateheaderwrapper templateheader templateheaderblockcontainer9
templatenavwrapper templatenav ul8
haut de page7
absolute left 505
left 50 top5
templatenav ul li5
bout de 14
1 seconde ifrenable4
seconde ifrenable windowsettimeoutfunction4
dblocage au bout4
fin de vie4
border 0 accompagnement4
pour ne pas4
height 60px padding4
eventwrapper eventpicture eventcountdownwrapper4
60px padding 04
120px height 240px3
top 120px height3
accordion accordioncontentaccordioncolor accordiontitlewrapper3
du grand ge3
boxes boxdata-typebutton buttondiycontainer3
templatesubnavwrapper ul li3
noteventcolor pour ne3
ne pas modifier3
pas modifier les3
modifier les puces3
puces de lagenda3
boxdata-typebutton buttondiycontainer buttondiywrapper3
hauteur du menu3
gridwrapper box buttondiycontainer3
box buttondiycontainer buttondiywrapper3
media min-width 1151px3
media max-width 1150px3
bloc templateheaderwrapper templateheader3
menu templatenavwrapper templatenav3
prend la hauteur3
padding 019
0important border18
position absolute18
absolute left18
0 margin18
margin 0important18
border 018
240px padding13
height 240px13
du menu13
templatenavwrapper templatenav13
templateheaderwrapper templateheader11
ul li9
0 top9
templateheader templateheaderblockcontainer9
left 09
templatenav ul8
buttondiycontainer buttondiywrapper6
hauteur du6
agendawrapper agendalist6
color 316bf25
50 top5
left 505
eventwrapper eventpicture5
templatesubnavwrapper ul5
dans le5
le haut4
height 60px4
ifrenable windowsettimeoutfunction4
seconde ifrenable4
1 seconde4
au bout4
dblocage au4
60px padding4
0 accompagnement4
couleur du4
le menu4
ne pas4
divnotagendawrapper agendaevent4
eventpicture eventcountdownwrapper4
background-color ffffff4
pour ne4
gridwrapper box3
boxdata-typebutton buttondiycontainer3
boxes boxdata-typebutton3
les puces3
modifier les3
pas modifier3
background-image urlhttpsweb-assoconnect-frc-prod-cdn-endpoint-softwareazureedgenetlegacycommonimagelayoutpublictexturesblankpng3
grand ge3
120px height3
noteventcolor pour3
templatenavsubbarwrapper templatenavsubbarwrapper3
templatebreadcrumb breadcrumbitems3
accordioncontentaccordioncolor accordiontitlewrapper3
accordion accordioncontentaccordioncolor3
top 120px3
du deuil3
du grand3
menu si3
si le3
du haut3
page templateheaderwrapper3
texture du3
bloc templateheaderwrapper3
max-width 1150px3
menu templatenavwrapper3
du contenu3
maladie grave3
media max-width3
les pages3
border-radius 5px3
templatenavwrapper templatenavwrapperbefore3
min-width 1151px3
media min-width3
box buttondiycontainer3
templatepage prend3
052
du39
padding22
height22
left21
position21
absolute20
margin19
border19
top19
menu18
0important18
templatenavwrapper17
background-color17
var16
les15
le15
ul14
templateheaderwrapper14
templatenav13
240px13
color12
des12
page11
function11
templateheader11
agendawrapper10
pas10
templatesubnavwrapper10
et10
un10
templateheaderblockcontainer9
pour9
hauteur9
dans9
return9
templatenavsubbarwrapper9
li9
est8
true8
316bf28
nos8
border-color8
ne8
haut7
accompagnement7
templatepage7
eventwrapper7
boxes7
couleur6
media6
buttondiycontainer6
si6
buttondom6
div6
buttondiywrapper6
bloc6
else6
false6
agendaevent6
agendalist6
5px6
eventpicture5
bnvoles5
templatenavcontainerheight5
formation5
vie5
heightmax5
site5
qui5
rivage5
15
sur5
25
au5
ffffff5
thisdatamulti-submit-protection4
pages4
bnvole4
34
windowsettimeoutfunction4
ifrenable4
seconde4
44
ge4
120px4
bout4
grand4
dblocage4
notre4
px4
blocage4
propdisabled4
60px4
buttoninterval4
fin4
text4
logo4
img4
icons4
max-width4
eventcountdownwrapper4
templatenavbar4
border-radius4
10px4
divnotagendawrapper4
width4
box4
templatebreadcrumb3
breadcrumbitems3
se3
cache3
implantation3
d039accompagnement3
accordiontitlewrapper3
deuil3
buttonwhitebluehover3
h23
une3
53
accordioncontentaccordioncolor3
grave3
sont3
accordion3
votre3
diy3
templatepageheight3
fonction3
templatenavcontainer3
prend3
windowheight3
body3
fentre3
buttonwhiteblueactive3
modifier3
maladie3
fond3
toujours3
contenu3
form3
important3
text-align3
20px3
texte3
urlhttpsweb-assoconnect-frc-prod-cdn-endpoint-softwareazureedgenetlegacycommonimagelayoutpublictexturesblankpng3
chargement3
background-image3
transparent3
non3
texture3
liactive3
dialogdotwrapper3
il3
1150px3
display3
templatenavwrapperbefore3
1151px3
min-width3
gridwrapper3
possible3
boxdata-typebutton3
lagenda3
puces3
l039association3
noteventcolor3
window3

Who hosts Association-rivage.net?

Association-rivage.net Hosting Provider Information

Hosted IP Address:213.186.33.5
Hosted Hostname:redirect.ovh.net
Service Provider:OVH SAS
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:Not Applicable

Is "OVH SAS" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
OVH SAS
1.2969%

HTTP Header Analysis for Association-rivage.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-store, no-cache, must-revalidate, no-cache, no-store, private
Pragma: no-cache, no-cache
Content-Length: 30189
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip
Expires: Thu, 19 Nov 1981 08:52:00 GMT, Sat, 28 Nov 2020 14:37:22 GMT
Vary: Accept-Encoding
P3P: CP="CAO PSA OUR"
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
Referrer-Policy: origin-when-cross-origin
Link:; rel="canonical", ; rel="http://www.w3.org/ns/hydra/core#apiDocumentation"
Access-Control-Allow-Origin: *
Content-Security-Policy: base-uri 'none';object-src 'self';script-src 'unsafe-inline' 'strict-dynamic' https: http: 'nonce-yXHddjVYBobPVCoUtRkdWTuX9V1TlzZj';
Strict-Transport-Security: max-age=31536000; preload
X-XSS-Protection: 1; mode=block
X-Azure-Ref: 0omDCXwAAAADGIresuyUoRIFdeBm32ahmTE9OMjFFREdFMDEwNgAyYjI0ZjVlNS1jMzQzLTRmYjgtODgyMy1hNGJiOWIzOTUzNGY=
Date: Sat, 28 Nov 2020 14:37:22 GMT

Association-rivage.net Domain Nameserver Information

HostIP AddressCountry
dns100.ovh.net 213.251.188.144
ns100.ovh.net 213.251.128.144


Need to find out who hosts Association-rivage.net?


Domain Registration (WhoIs) information for Association-rivage.net

 Domain Name: association-rivage.net
Registry Domain ID: 2253353161_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.ovh.com
Registrar URL: https://www.ovh.com
Updated Date: 2020-04-01T09:54:41.0Z
Creation Date: 2018-04-17T14:13:13.0Z
Registrar Registration Expiration Date: 2021-04-17T14:13:13.0Z
Registrar: OVH, SAS
Registrar IANA ID: 433
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +33.972101007
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Association Rivage
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province:
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: FR
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Login to show email
Admin ID:
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Login to show email
Tech ID:
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Login to show email
Server: dns100.ovh.net
Name Server: ns100.ovh.net
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System:
http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-06-01T02:52:42.0Z

Websites with Similar Names

Assoc-admin.com
Redirection...
Assoc-ahaem.com
Présentation de l'Association AHAEM
Assoc-amal.com
Association Amal de Chasse ????????????? ??????? ?????????????
Assoc-bad.ru
Парковая страница X-HOST.UA
Assoc-basma.org
بسمة لكفالة اليتيم والخدمات الإجتماعية – جمعية بسمة لكفالة اليتيم والخدمات الإجتماعية
Assoc-cx.com
Currency Exchange | Associated Currency Exchange | Chicago
Assoc-football.com
Association Football | an American soccer blog – covering the world's game from a new world perspective
Assoc-hdqts.org
Association Headquarters

Recently Updated Websites

Hotspot.fit (1 second ago.)Mytele.doctor (2 seconds ago.)Flygym.club (3 seconds ago.)Jpalfrey.blog (3 seconds ago.)Anubansal.engineer (3 seconds ago.)Anime-gluttony.digital (4 seconds ago.)Abundance.bet (4 seconds ago.)Bettyboot.app (4 seconds ago.)Proleptic.app (6 seconds ago.)Tradeu.exchange (6 seconds ago.)Modfi.club (7 seconds ago.)Envolvent.cat (7 seconds ago.)Oroc.group (7 seconds ago.)Tecnotitin.club (8 seconds ago.)Psl.fan (9 seconds ago.)Hothouse.digital (9 seconds ago.)Avgs.hamburg (9 seconds ago.)Hdytrip.club (10 seconds ago.)Travisrobinson.dev (11 seconds ago.)Lzwlzw.club (11 seconds ago.)Worlddermafillers.com (11 seconds ago.)Kaw.foundation (11 seconds ago.)Bideadamag.club (11 seconds ago.)Cyberestatesales.estate (13 seconds ago.)Kissmillionaires.com (13 seconds ago.)Percorsoeconomico.blog (14 seconds ago.)Zooomeee.com (14 seconds ago.)Xjwqbv.com (15 seconds ago.)Darganerimn0090.fun (15 seconds ago.)Myroaster.coffee (15 seconds ago.)

Recently Searched Keywords

term insurance (1 second ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (3 seconds ago.)on site seminar (3 seconds ago.)wallet (4 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (6 seconds ago.)yandex translate (7 seconds ago.)claudiu tel97477907693 mailaq8systememsgmailcom (9 seconds ago.)hog outs (9 seconds ago.)1152margin-left (12 seconds ago.)composing a paper about military technology (14 seconds ago.)czsto (16 seconds ago.)卫浴品牌 (16 seconds ago.)harum (17 seconds ago.)火鍋 (20 seconds ago.)rogue one (25 seconds ago.)cashuback (25 seconds ago.)chair covers (26 seconds ago.)voir ce produit (27 seconds ago.)amerikanisch essen (28 seconds ago.)南区 (29 seconds ago.)promo via wa (33 seconds ago.)true eventname internal (34 seconds ago.)stalkerzone (37 seconds ago.)美食 (38 seconds ago.)lambeth (40 seconds ago.)homephoto (41 seconds ago.)spoiler1-toggleis-collapsed ifa-minus (42 seconds ago.)machinelearning (43 seconds ago.)open trusted cloud program (47 seconds ago.)ocuklar (48 seconds ago.)