Auction.co.kr  |  
Low trust score  | 



Auction.co.kr Website Information

Website Ranks & Scores for Auction.co.kr

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:1,109
Majestic Rank Majestic Rank:27,237
Domain Authority Domain Authority:68%
DMOZ DMOZ Listing:Yes

Whois information for auction.co.kr

Full Whois Lookup for Auction.co.kr Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Auction.co.kr. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

query : auction.co.kr

# KOREAN(UTF8)

????? : auction.co.kr
??? : ???? ??????
??? : ???? ??????
??? ???? : Login to show email
: 1998. 03. 11.
?? ?? ??? : 2016. 11. 01.
?? ??? : 2018. 10. 15.
?????? : N
????? : (?)???(http://whois.co.kr)
DNSSEC : ???

1? ???? ??
????? : ns1.cdnetdns.net

2? ???? ??
????? : ns2.cdnetdns.net

???? ??? .kr? ?? ??? IP??? ??? ????.

# ENGLISH

Domain Name : auction.co.kr
Registrant : eBay Korea Co., Ltd.
Administrative Contact(AC) : eBay Korea Co., Ltd.
AC E-Mail : Login to show email
Date : 1998. 03. 11.
Last Updated Date : 2016. 11. 01.
Expiration Date : 2018. 10. 15.
Publishes : N
Authorized Agency : Whois Corp.(http://whois.co.kr)
DNSSEC : unsigned

Primary Name Server
Host Name : ns1.cdnetdns.net

Secondary Name Server
Host Name : ns2.cdnetdns.net

?? ??? UTF-8 ????? ????? ????.
EUC-KR ??? ???? oldwhois.kisa.or.kr?? ??? ?? ????.
The above information is encoded with UTF-8
EUC-KR encoding WHOIS is being serviced in this URL:oldwhois.kisa.or.kr

- KISA/KRNIC WHOIS Service -

Who hosts Auction.co.kr?

Auction.co.kr is hosted by LG DACOM Corporation in Seoul-t'ukpyolsi, Seoul, Korea, Republic Of, 135-010.
Auction.co.kr has an IP Address of 211.233.17.11 and a hostname of auction.co.kr.



Auction.co.kr Web Server Information

Hosted IP Address:211.233.17.11
Hosted Hostname:auction.co.kr
Service Provider:LG DACOM Corporation
Hosted Country:South KoreaKR
Location Latitude:37.5683
Location Longitude:126.978
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for Auction.co.kr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Length: 11447
Content-Type: text/html
Content-Encoding: gzip
Content-Location: http://auction.co.kr/default.html
Last-Modified: Mon, 08 Jun 2015 04:02:41 GMT
Accept-Ranges: bytes
ETag: "80466f79fa1d01:83b"
Vary: Accept-Encoding
Server: Microsoft-IIS/6.0
P3P: CP="CAO DSP LAW CUR ADM DEV TAI PSA IVAo CONo HISo OUR DEL LEG SAMo UNI COM PUR NAV INT STA"
X-Powered-By: ASP.NET
Date: Mon, 08 Jun 2015 04:04:32 GMT


Need to find out who hosts Auction.co.kr?

Auction.co.kr Free SEO Report

Website Inpage Analysis for Auction.co.kr

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Auction.co.kr

undefinedreqnofrmstyleheightcatchdocumentcreateelementiframefalse3ex0pxfrmtruefunctionfrm documentcreateelementiframereturn varcatch exdeferreddeferredresolve donefunctionif typeofdeferredfunctiondeferredresolveex vardeferred deferredresolvefrmsrcmembertypevar frmreturn1smileclublayerdisplayvar frm documentcreateelementiframeelseisnotmemberdeferredfunction deferredtypeoffrmstylewidth2dtnowtryadhtmlbannersdocumentbodyappendchildfrmnewrvirelateitemslotiniteddonefunctionadhtml adhtmldeferredfunction deferred deferredresolveallheightdefaultimageif0nullvarstrtagdeferred deferredresolve donefunction

Longtail Keyword Density for Auction.co.kr

KeywordsOccurences
var frm documentcreateelementiframe3
deferred deferredresolve donefunction3
deferredfunction deferred deferredresolve3
if typeof7
catch ex6
adhtml adhtml4
var frm3
frm documentcreateelementiframe3
return var3
ex var3
deferred deferredresolve3
deferredresolve donefunction3
deferredfunction deferred3
var30
if28
ex11
undefined11
function9
adhtml8
false8
typeof7
07
try6
null6
catch6
true6
strtag5
return5
15
24
new4
0px4
else4
smileclublayerdisplay4
isnotmember4
frmsrc3
frmstylewidth3
frmstyleheight3
reqno3
banners3
documentcreateelementiframe3
documentbodyappendchildfrm3
defaultimage3
height3
deferredresolve3
deferred3
deferredfunction3
33
donefunction3
rvirelateitemslotinited3
dtnow3
membertype3
all3
frm3

What are the nameservers for auction.co.kr?

Auction.co.kr Domain Nameserver Information

HostIP AddressCountry
ns1am.auction.co.kr 183.111.131.40South Korea South Korea
ns1.auction.co.kr 211.233.17.12South Korea South Korea
ns2.auction.co.kr 211.233.17.13South Korea South Korea

Auction.co.kr DNS Record Analysis DNS Lookup

HostTypeTTLExtra
auction.co.krA286IP: 211.233.17.11
auction.co.krNS299Target: ns1am.auction.co.kr
auction.co.krNS299Target: ns1.auction.co.kr
auction.co.krNS299Target: ns2.auction.co.kr
auction.co.krSOA300MNAME: ns1.auction.co.kr
RNAME: dolbam.auction.co.kr
Serial: 2015060301
Refresh: 60
Retry: 900
Expire: 604800
auction.co.krMX300Priority: 10
Target: data.ebay.com
auction.co.krMX300Priority: 10
Target: gort.ebay.com
auction.co.krMX300Priority: 10
Target: lore.ebay.com
auction.co.krTXT300TXT: v=spf1 ip4:211.233.17.0/24
ip4:211.115.78.0/24 ip4:222.231.5.0/24
ip4:121.138.165.0/24
ip4:216.113.175.0/24 ip4:193.28.178.0/24
ip4:216.33.244.0/24 -all

Alexa Traffic Rank for Auction.co.kr


Alexa Search Engine Traffic for Auction.co.kr