IIS Windows Server

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 958,540
Estimated Worth: $1,440

Useful Searches

audiovideohd

,


Domain summary

Last updated
2021-12-02
Domain label
audiovideohd
Domain extension
fr
Domain registered:
2020-02-17
Domain updated:
2021-03-29
Global Traffic Rank
958,540
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,440
Estimated daily income
$6
Estimated monthly income
$183

Frequently Asked Questions (FAQ)

Q: When was Audiovideohd.fr registered?
A: Audiovideohd.fr was registered 1 year, 11 months, 1 week, 4 days, 2 hours, 9 minutes, 51 seconds ago on Monday, February 17, 2020.
Q: When was the WHOIS for Audiovideohd.fr last updated?
A: The WHOIS entry was last updated 9 months, 4 weeks, 2 days, 2 hours, 9 minutes, 51 seconds ago on Monday, March 29, 2021.
Q: What are Audiovideohd.fr's nameservers?
A: DNS for Audiovideohd.fr is provided by the following nameservers:
  • ns1040.ui-dns.com
  • ns1062.ui-dns.de
  • ns1106.ui-dns.org
  • ns1120.ui-dns.biz
Q: Who is the registrar for the Audiovideohd.fr domain?
A: The domain has been registered at AFNIC.
Q: What is the traffic rank for Audiovideohd.fr?
A: Audiovideohd.fr ranks 958,540 globally on Alexa. Audiovideohd.fr has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Audiovideohd.fr each day?
A: Audiovideohd.fr receives approximately 918 visitors and 1,836 page impressions per day.
Q: What IP address does Audiovideohd.fr resolve to?
A: Audiovideohd.fr resolves to the IPv4 address 51.68.97.152.
Q: In what country are Audiovideohd.fr servers located in?
A: Audiovideohd.fr has servers located in the France.
Q: What webserver software does Audiovideohd.fr use?
A: Audiovideohd.fr is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Audiovideohd.fr?
A: Audiovideohd.fr is hosted by Microsoft Corporation in France.
Q: How much is Audiovideohd.fr worth?
A: Audiovideohd.fr has an estimated worth of $1,440. An average daily income of approximately $6, which is roughly $183 per month.

Audiovideohd.fr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Audiovideohd.fr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Audiovideohd.fr

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

1:

Links - Outbound (nofollow)

0:

Who hosts Audiovideohd.fr?

Audiovideohd.fr Hosting Provider Information

Hosted IP Address:51.68.97.152
Hosted Hostname:ip152.ip-51-68-97.eu
Service Provider:Microsoft Corporation
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:Microsoft-IIS/8.5

Is "Microsoft Corporation" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
Microsoft Corporation
0.1269%

HTTP Header Analysis for Audiovideohd.fr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html
Content-Encoding: gzip
Last-Modified: Tue, 03 Mar 2020 08:07:33 GMT
Accept-Ranges: bytes
ETag: "836bcfca32f1d51:0"
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
X-Powered-By: ASP.NET
Date: Thu, 02 Dec 2021 18:43:17 GMT
Content-Length: 608

Audiovideohd.fr Domain Nameserver Information

HostIP AddressCountry
ns1040.ui-dns.com 217.160.82.40
ns1062.ui-dns.de 217.160.80.62
ns1106.ui-dns.org 217.160.83.106
ns1120.ui-dns.biz 217.160.81.120


Need to find out who hosts Audiovideohd.fr?


Domain Registration (WhoIs) information for Audiovideohd.fr

 %%
%% This is the AFNIC Whois server.
%%
%% complete date format : YYYY-MM-DDThh:mm:ssZ
%% short date format : DD/MM
%% version : FRNIC-2.5
%%
%% Rights restricted by copyright.
%% See https://www.afnic.fr/en/products-and-services/services/whois/whois-special-notice/
%%
%% Use '-h' option to obtain more information about this service.
%%
%% [18.133.238.17 REQUEST] >> audiovideohd.fr
%%
%% RL Net [##########] - RL IP [#########.]
%%

domain: audiovideohd.fr
status: ACTIVE
hold: NO
holder-c: E93755-FRNIC
admin-c: E93756-FRNIC
tech-c: UIS153-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL399271-FRNIC
registrar: IONOS SE
Expiry Date: 2022-03-29T07:02:01Z
created: 2020-02-17T07:32:16Z
last-update: 2021-03-29T07:38:44Z
source: FRNIC

ns-list: NSL399271-FRNIC
nserver: ns1040.ui-dns.com
nserver: ns1062.ui-dns.de
nserver: ns1106.ui-dns.org
nserver: ns1120.ui-dns.biz
source: FRNIC

registrar: IONOS SE
type: Isp Option 1
address: Ernst-Frey Strasse 9
address: 76135 KARLSRUHE
country: DE
phone: +49 721 91374 50
fax-no: +49 721 91374 215
e-mail: Login to show email
https://ionos.com
anonymous: NO
registered: 2001-01-17T12:00:00Z
source: FRNIC

nic-hdl: E93755-FRNIC
type: ORGANIZATION
contact: EKLIPSEO
address: EKLIPSEO
address: 12 Rue des Macabeus
address: 66300 PONTEILLA
country: FR
phone: +33.788035057
e-mail: Login to show email
IONOS SE
changed: 2020-03-29T06:43:17Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: E93756-FRNIC
type: ORGANIZATION
contact: EKLIPSEO
address: EKLIPSEO
address: 12 Rue des Macabeus
address: 66300 PONTEILLA
country: FR
phone: +33.788035057
e-mail: Login to show email
IONOS SE
changed: 2020-03-29T06:43:19Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: UIS153-FRNIC
type: ORGANIZATION
contact: 1&1 Internet SARL
address: 1&1 Internet SARL
address: 7, place de la Gare
address: 57200 Sarreguemines
country: FR
phone: +33 9 70 80 89 11
fax-no: +33 3 87 95 99 74
e-mail: Login to show email
IONOS SE
changed: 2015-06-30T07:14:37Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

Websites with Similar Names

Audio-10.com
Original-Autoradio.de - Original-Autoradio.de
Audio-360.com
Homepage | Audio 360
Audio-365.com
audio-365.com
Audio-accessibility.com
Let's Think Outside The Ears! - Audio Accessibility
Audio-acoustical.com
audio-acoustical.com
Audio-activist.com
Audio Activist — Coming Soon>
Audio-ad.work
audio-ad.work – このドメインはお名前.comで取得されています。

Recently Updated Websites

Bilderrahmeneifel.com (3 seconds ago.)Mediahorizons.com (3 seconds ago.)Nowahalamedia.xyz (6 seconds ago.)Tesla3.ca (8 seconds ago.)Womenswaysofjamming.com (8 seconds ago.)Ogdolls.com (8 seconds ago.)Qp596.net (9 seconds ago.)Sixeats.com (11 seconds ago.)Phanhky.com (12 seconds ago.)Abdolzade.com (12 seconds ago.)Jacobsoninsurancefirm.com (13 seconds ago.)Solare.events (14 seconds ago.)Iceconsults.com (14 seconds ago.)Platfrm.dev (15 seconds ago.)Jujubelles.com (16 seconds ago.)Thomleany.com (17 seconds ago.)Democracyreformlab.com (18 seconds ago.)Christianbuildersltd.com (18 seconds ago.)Ceramicarts.com (18 seconds ago.)Nextgensoft.in (19 seconds ago.)Buenastareas.com (19 seconds ago.)Raffloo.com (21 seconds ago.)Dinrecords.fr (22 seconds ago.)Soulspa.space (22 seconds ago.)Adawatmanzeliah.com (23 seconds ago.)Iwebroots.com (23 seconds ago.)Bicomole.com (23 seconds ago.)Lifeofabackpacker.com (23 seconds ago.)8887620.com (24 seconds ago.)Computersjobs.com (24 seconds ago.)

Recently Searched Keywords

open policy (1 second ago.)mls coverage (1 second ago.)we believe you are the progress (1 second ago.)animationlinktargetblanktypewixdatapageidgt1mntargetselftypepagelinkpagenameabsolute (2 seconds ago.)top 5 champion generators – reviews and buying guide (2 seconds ago.)gbb (2 seconds ago.)japona (3 seconds ago.)javascript reference (3 seconds ago.)nci-doe collaboration 2021 virtual workshops: accelerating precision radiation oncology through advanced computing and artificial intelligence (5 seconds ago.)crystal blue (5 seconds ago.)kismet meaning (5 seconds ago.)documentgetelementbyidcomponentvalue documentgetelementbyidcomponentdisabled false (6 seconds ago.)view venues (9 seconds ago.)опасные связи сезон 3 выпуск 26 (10 seconds ago.)penina park (11 seconds ago.)leap view (13 seconds ago.)you will fill (13 seconds ago.)adamallys llc careers (15 seconds ago.)mskie (16 seconds ago.)quicksprout guides (16 seconds ago.)id url (18 seconds ago.)dm2 (18 seconds ago.)日本搭讪行:超敢玩的仙台美眉登场 (20 seconds ago.)08-18.女同剪刀式性愛 (20 seconds ago.)primbon, ramalan (21 seconds ago.)آذرشهر (21 seconds ago.)last guardian (22 seconds ago.)potroni (22 seconds ago.)widgetwidgetnavmenu menu-item abefore (25 seconds ago.)merchandise home (25 seconds ago.)