Holger Zier – Augen Naturheilpraxis Zier in Konstanz am Bodensee

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-05-01
Domain label
augen-acupunktur
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Augen-acupunktur.de registered?
A: Augen-acupunktur.de was registered 6 months, 4 weeks, 23 hours, 57 minutes, 58 seconds ago on Saturday, May 1, 2021.
Q: When was the WHOIS for Augen-acupunktur.de last updated?
A: The WHOIS entry was last updated 9 years, 7 months, 4 days, 23 hours, 57 minutes, 58 seconds ago on Wednesday, April 25, 2012.
Q: What are Augen-acupunktur.de's nameservers?
A: DNS for Augen-acupunktur.de is provided by the following nameservers:
  • docks05.rzone.de
  • shades05.rzone.de
Q: Who is the registrar for the Augen-acupunktur.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Augen-acupunktur.de?
A: Augen-acupunktur.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Augen-acupunktur.de each day?
A: Augen-acupunktur.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Augen-acupunktur.de resolve to?
A: Augen-acupunktur.de resolves to the IPv4 address 81.169.145.86.
Q: In what country are Augen-acupunktur.de servers located in?
A: Augen-acupunktur.de has servers located in the Germany.
Q: What webserver software does Augen-acupunktur.de use?
A: Augen-acupunktur.de is powered by Apache/2.4.46 (Unix) webserver.
Q: Who hosts Augen-acupunktur.de?
A: Augen-acupunktur.de is hosted by Strato AG in Germany.
Q: How much is Augen-acupunktur.de worth?
A: Augen-acupunktur.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Augen-acupunktur.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Augen-acupunktur.de Free SEO Report

Website Inpage Analysis for Augen-acupunktur.de

H1 Headings

0 :

H2 Headings

7 :
  1. Augen Naturheilpraxis Zier
  2. Liebe Patientin, lieber Patient
  3. Die Therapiemöglichkeiten
  4. Wissenswertes
  5. ERNÄHRUNG FÜR DAS AUGE
  6. Die Praxis
  7. Sie haben Fragen zus unsern Therapiemöglichkeiten?

H3 Headings

1 :
  1. Wir beraten sie gerne. Vereinbaren sie einen Termin oder schreiben sie uns

H4 Headings

12 :
  1. Praxis in Konstanz
  2. Terminabsprache
  3. Praxis in Berlin
  4. AUGENTHROMBOSE / EMBOLIE – „AUGENINFARKT“
  5. GLAUKOM
  6. KATARAKT
  7. MAKULADEGENERATION TROCKEN/FEUCHT
  8. RETINITIS PIGMENTOSA
  9. SICCA SYNDROM / TROCKENES AUGE
  10. THERAPIEN
  11. Wissenwert
  12. Hinweis

H5 Headings

1 :
  1. Wir informieren über folgende Augenerkrankungen

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

11 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

20:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Augen-acupunktur.de

mitdenkonstanzhgrtopnavbarextrasdannwarumbeisiehgrtopnavbarcontainerouterheightuns aufaugeaufsichwirunsberpatientaugenerkrankungenunsererhierbehandlungdaspatiententherapiemglichkeitenpraxiswerdenistaugenkapselndiefragenderkontaktfrzuzieraugen

Who hosts Augen-acupunktur.de?

Augen-acupunktur.de Hosting Provider Information

Hosted IP Address:81.169.145.86
Hosted Hostname:w86.rzone.de
Service Provider:Strato AG
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache/2.4.46 (Unix)

Is "Strato AG" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
15.7989%
GOOGLE
14.3607%
AS-26496-GO-DADDY-COM-LLC
3.8534%
NAMECHEAP-NET
3.1479%
AMAZON-AES
2.3132%
GoDaddy.com, LLC
2.0763%
UNIFIEDLAYER-AS-1
1.9874%
Fara Negar Pardaz Khuzestan
1.6407%
CONFLUENCE-NETWORK-INC
1.4732%
1&1 Internet AG
1.3797%
STRATO AG
0.3063%

HTTP Header Analysis for Augen-acupunktur.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 01 May 2021 15:22:50 GMT
Server: Apache/2.4.46 (Unix)
X-Powered-By: PHP/7.4.16
Link:; rel=shortlink
Vary: User-Agent
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked

Augen-acupunktur.de Domain Nameserver Information

HostIP AddressCountry
docks05.rzone.de 217.160.80.132
shades05.rzone.de 217.160.82.132


Need to find out who hosts Augen-acupunktur.de?


Domain Registration (WhoIs) information for Augen-acupunktur.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: augen-acupunktur.de
Nserver: docks05.rzone.de
Nserver: shades05.rzone.de
Status: connect
Changed: 2012-04-25T21:25:08+02:00

Websites with Similar Names

Augen-acupunktur.de
Holger Zier – Augen Naturheilpraxis Zier in Konstanz am Bodensee
Augen-arzt-berlin.de
Augenarzt Berlin am Platz der Luftbrücke | Leben ohne Brille
Augen-arzt-muenchen.de
Augenarzt München - Augenzentrum München Süd
Augen-auf-bremen.de
Augen Auf | Augen auf
Augen-auf-reise.de
Augen-auf-Reise | Erfahrungen und Berichte einer Weltreise
Augen-auf.online
Augen Auf Online
Augen-blankenese.de
Augenarzt Hamburg | Dr. Kaupke + Partner | Augenarztpraxis
Augen-blick-vluyn.com
Augen-Blick - STARTSEITE
Augen-blicke.net
Augen-Blicke - STARTSEITE

Recently Updated Websites

Breezemaxxdirect.com (8 seconds ago.)Andrad.pl (8 seconds ago.)Butchershoppedeals.com (10 seconds ago.)Selfserveaudition.com (13 seconds ago.)Metrococksucker.com (16 seconds ago.)Qualiumtrip.com (18 seconds ago.)Dirtyroses.net (19 seconds ago.)Envy-soul.fr (20 seconds ago.)Yayuvip3646.vip (20 seconds ago.)Sup79.com (23 seconds ago.)Gzsytw.com (26 seconds ago.)Rogerstrahan.net (28 seconds ago.)Abbymiddleton.com (30 seconds ago.)Mallorcahoa.org (31 seconds ago.)Earlandtiff.com (31 seconds ago.)Wemakedough.com (36 seconds ago.)Vinascloset.com (37 seconds ago.)Regroupement-decredit.com (43 seconds ago.)Seventyonewentworth.com (44 seconds ago.)Bitcoinfaucetsland.com (44 seconds ago.)Oregonproducts.co.uk (45 seconds ago.)Cgwork.com (45 seconds ago.)Ka1zr.com (49 seconds ago.)Footlocal.com (49 seconds ago.)Aviftw.win (49 seconds ago.)Tidee.dev (53 seconds ago.)Pmwindows.org (54 seconds ago.)Ceusonlinesite.com (57 seconds ago.)Monedalibre.app (58 seconds ago.)Pnwrelife.info (1 minute 1 second ago.)

Recently Searched Keywords

мейер марисса (1 second ago.)kool aid hair dye (1 second ago.)backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle (1 second ago.)early age (1 second ago.)dirty anal (1 second ago.)sel-selected sel-arraw (1 second ago.)repudiandae nostrum (1 second ago.)u0000-00ff (2 seconds ago.)profil du membre (2 seconds ago.)blazers  (4 seconds ago.)priming moisturizer httpsgooglrhbcd2 (6 seconds ago.)ede (6 seconds ago.)experience you (7 seconds ago.)postads id (10 seconds ago.)fies o caminho mais rápido para chegar na universidade (11 seconds ago.)nemo date (11 seconds ago.)вечерние прически на средние волосы 2019 (12 seconds ago.)sunt officia (12 seconds ago.)plan of salvation (13 seconds ago.)php code snippets (16 seconds ago.)consectetur use (16 seconds ago.)restaurant la belle epoque (16 seconds ago.)$1235 (16 seconds ago.)namm (18 seconds ago.)petit ��lectrom��nager (18 seconds ago.)fzmoviez.in bollywood (18 seconds ago.)20px14em playfairdisplay-boldplayfair (18 seconds ago.)parque infantil (20 seconds ago.)dates and events in history (20 seconds ago.)women in power artist collab (20 seconds ago.)