Autobild.de  |  AUTOBILD.DE - Testberichte - Automarkt - Autokauf
High trust score  | 
Das Internetportal zum Thema Auto. Hier finden Sie Testberichte, Kaufberatung und mehr als 700.000 Autos im Automarkt.




Autobild.de Website Information

Website Ranks & Scores for Autobild.de

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:8,281
Majestic Rank Majestic Rank:7,531
Domain Authority Domain Authority:76%
DMOZ DMOZ Listing:No

Whois information for autobild.de

Full Whois Lookup for Autobild.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Autobild.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: autobild.de
Nserver: a1-130.akam.net
Nserver: a11-67.akam.net
Nserver: a14-64.akam.net
Nserver: a16-65.akam.net
Nserver: a6-66.akam.net
Nserver: a7-67.akam.net
Nserver: ns11.netuse.de
Dnskey: 257 3 8 AwEAAdSLtmbsgZW5kcJzdvbTu+6xupvx8SBvZhXXVnMf+/HggH8EVrNRVUpHGLdE/caYQrFhxM1SqkZT0Zu+9xqUrLQn1EjUIUymPZP3mm795oaZn4sVteDW0NxHsFLwdwgXR3v3l8SuPmPgHnosconUCCYB2vBh53e2yB3XJ8/c8c/wOzlsEHFMhJlZUNQLWHwimrkdCYtoldOh2+uSrD5hMRaHNX/0I8KOY/PPQL1bgiFedMnMBdMeT6NY/AtRiBCDLJCUr2PRfKnuubI8Cf6Eg3PzJJqQEEfqF/DO4vNZ4HVWzNB2XPBKuC0OYqODhVzXwfZRxk53pIcIAlmARR/L1T8=
Status: connect
Changed: 2017-03-13T10:15:33+01:00

[Tech-C]
Type: PERSON
Name: Hostmaster of the Day
Organisation: NetUSE AG
Address: Dr.-Hell-Strasse
PostalCode: 24107
City: Kiel
CountryCode: DE
Phone: +49.4312390400
Fax: +49.4312390499
Email: Login to show email
2016-12-12T16:57:34+01:00

[Zone-C]
Type: PERSON
Name: Hostmaster of the Day
Organisation: NetUSE AG
Address: Dr.-Hell-Strasse
PostalCode: 24107
City: Kiel
CountryCode: DE
Phone: +49.4312390400
Fax: +49.4312390499
Email: Login to show email
2016-12-12T16:57:34+01:00

Who hosts Autobild.de?

Autobild.de is hosted by Vodafone GmbH in Bavaria, Igensdorf, Germany, 91338.
Autobild.de has an IP Address of 195.50.176.50 and a hostname of www.autobild.de.



Autobild.de Web Server Information

Hosted IP Address:195.50.176.50
Hosted Hostname:www.autobild.de
Service Provider:Vodafone GmbH
Hosted Country:GermanyDE
Location Latitude:49.6245
Location Longitude:11.2401
Webserver Software:Not Applicable

HTTP Header Analysis for Autobild.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 09 Jun 2015 14:13:18 GMT
Server: Apache
Cache-Control: max-age=300, public
Expires: Tue, 09 Jun 2015 14:18:18 GMT
Access-Control-Allow-Origin: www.autobild.de
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 38853
Connection: close
Content-Type: text/html


Need to find out who hosts Autobild.de?

Autobild.de Free SEO Report

Website Inpage Analysis for Autobild.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-2557501611105071
Google Analytics:Not Applicable

Keyword Cloud for Autobild.de

bildneuelsersmobileswitchsastarget bid5922vettel vettel staumlrkercamperkoreanerstringinsignia sports31detailsfff videohighlightz4eur 6000 eurmit 510 ps21rs5jetzt mithalten5 uumlberarbeitet plusopelundefinedsaspageid10017home seitevipercee39dkommtgolfbittetest quotflugstundequot imconcept z4automarktbottomofelementconceptvar element300x100 sastarget targeting2500 eur 30001500 eurm760koleosskurrilebauen15000 eurjaguar20000 eur 25000porsche cayennenach der sommerpausemediaplayerdataloaderaddtransformatorfunction datanewsvwpremiere noch im75000 eurformblockeur 3000 eurheightsearchbar formblock fieldes vom 18ruumlckreisewelle laumluft kommtmargin 0uumlbersicht abttest kann dereoriginaleventtouches0pagexerste27videosliderwrappercssmarginleft marginleft8000 eur 9000guumlnstigvideosliderstartmargin marginleftseite autobilddehometuningschon teures auto10000 eursanta feviel platz imzur mobilansichttokyo12haben26luxusrenner superteure sonderausstattungtokyo motorjetzt mithalten renaultford mondeo5000 eur 6000sascallad undefinedconnected car20 august beimmodelluumlberblick abt rs5setzt auf vettelpadding 10pxauf gelassenheitvergleichplatzextremsprintden mondeoeoriginaleventtouches0pagex epagex16car3000 eurfordcockpitschutzkofferraum skoda superbabt hatimmerhostnamefuumlr diesupersportler imsuchenlegt den koleosstaumeldungen aktuelle3smartadserverajaxsaspageidsasformatidsastarget ifclickvom 18beitraumlge im uumlberblickneuen insigniaeur 20000den richtigen wertkofferraum opelvettel vettel2017 vorschauabt sportslineschliessenvonauto bildtopeoriginaleventtouches eoriginaleventtouches0pagex epagex0 searchbar formblocknumberkommt es vom39nvielder fabelhaftebmw m760legt denautobilddehome pageid74016mithalten renault legtcombi deralle themen newsanzeigediesedauertesterabt rs5mittelklassekombisradarfallensastarget bid5922 smartadserverajaxsaspageidsasformatidsastarget15000 euro ausstattungsextrasluxusrenner superteurecheckden koleosford mondeo turnierbild zeigt10000 eur 1250018 bisautofahren auf17500 euretron quattro 2018gaactiontitlebildertouchxmarkt und schonim checkder ideale zweitwohnsitzautobilddehomevideo kofferraum opel33cx5jqueryselector0 0ausstattungsextras machen eingetjson138eur 5000uumlberarbeitettypeof sascallad undefined50000 eur35zum beispielpanamera 4s dieselmobilansicht derleichteur 2500im vergleichder koleosder idealequattro 2018ein ohnehin schongeflochtenemobilers5 mit 510z4 concept 2017xdriveeur 1000kannerlkoumlnigeabspielenpictureblockwinnebago travato wohnmobiltestmondeo turnierpluginsneuem760 li29elementpreisdata nextskoda superbausstattungsextrasmarko setzt aufso koumlnnte dertypeofbis 20 auguststaumeldungen aktuelle stauprognosevideosliderstartmarginshareausifparam stringcx5renault koleosersteneur 15000autofahrenrs 5 uumlberarbeitetsoohnehinkoumlnnte deraudi etronelektrobmwrs 525test kannvideohighlight videotextv12 im testerfolgebeitraumlgechip draufsupercarcrashopel insigniamercedestourerpreis fuumlrv12 im17kaufberatungmehrsportscarserfolge zuminsigniashow functioneventwohnmobiltest dercayenne 2017 mitfahrtwelche20 augustbeim autofahren aufxmobilefixedheadlinetravato wohnmobiltest dersiegoldene lenkradformblock fieldlenkradvoreinfachemehr zum themadaskofferraum opel insigniafabelhafte winnecatosports tourerquattrokommt deralle markenneuen abtmodelle uumlbersicht20000 eurgegen mazda cx5premiere8000 eurkofferraum ford mondeovideosliderthresholdtouchendneueneur 1500hyundai santauumlbersicht abt sportslinepositionfalseso koumlnntewietest gegeneur 12500videohighlight sharefahren30000 eurslidercontentwennwohnmobilefuumlr 15000video porschedieselampwinnebago travatodurchsichfrisch auf demeur 500002017 jaguarsaisonvideo abspieleneurtoyotaeur 30000augustvideosliderclickingolsson1000 eurim top7er500 eur 1000bordermitfahrtseitevw golfthisavailable4s dieselcx5 und hondavardeactivatelinkcheckerwartetbeiif bottomofwindows exclusive geflochtenemediaplayerdatathemeautobild1widthvettel staumlrker nachturbo s exclusivepowermarginleftauf dieder lademeistertarget2checkeruumlberarbeitet plus alleteuerinfosschoneur 100000 eur50000 eur 75000cx5renaultcrvmazdapanamera 4s6etronvolkswagenmarketargeting smartadserversaspageidsasformatidsastargetim neuen insigniabild reisemobilzeigteuro ausstattungsextras machenmesseneur 25000 eurblitzersuperb combi dermitsommerpausefabelhafteabspielen video kofferraumdie ruumlckreisewelle laumluftif videosliderstartmarginauto bild reisemobilstaumlrker nach der2410aussehenmit 500 psplatz im neuenkoleos test kanncolor fffsportslineautos500 psvsmargincabriomotorschon getuntsliderdie neuecrvmazda cx5renaultneuer elektrobmwkoleos neutokyo motor showmit demeur 10000windowtest quotflugstundequotklassik2 saspageid 10017homealle 500exclusivestaumlrker nachstorieshyundait 410koleos neu aufporsche 911bid5922 smartadserverajaxsaspageidsasformatidsastarget ifnur13zweitwohnsitzboxermotorisandroidcromedes jahreslineheight10017homeluftdrucknderung dertextmarko setzt1 markoabjahres 2017abspielen video porscheesskoda superb combidiesel test nochauf vettel vettel15000 eur 17500honda crvfeplus alle neuenturnierformel 17000 eurdtmmondeo turnier dasdatagwmhm teaser30000 eur 40000smittelklassekombis imps frisch aufmazda cx50 searchbar15august beimbeim autofahrenbmwgibtauto leicht zummalibu teuro ausstattungsextrasporsche cayenne 2017erwartet erfolgebuttonmediaplaybeforeseite autobilddehome pageid74016eur 1000 eurmarginleft parseintvideosliderwrappercssmarginleftreplacepx500 eur4000 eurps34das passtbildergalerie halodesigns sokofferraumhonda crvmazda cx5renaultder koleos jetzteur 8000travatoallelaumluftnachneuwagenlimediaposter buttonmediaplaybeforesasformatid sascalladsasformatidnextfirsttravato wohnmobiltestif typeof sascalladvideosliderwrappercssmarginleft32ausstattungsextras machenerlkoumlnig audimodelluumlberblickmittelklassekombis im checktargetderftypevettel staumlrkerzum superteuren luxusrennerkastenwagenklassikerdata action12500 eurparam jquerysuperteure sonderausstattungaktionenaktuelle stauprognoseeur 30000 eur40000 eur 500001500 eur 2000pageid74016diemachen ein ohnehinsasformatid510 ps frischstaumeldungen100000 eureur 15000 eurjahresneuwagenkonfiguratorurl300 20pxvomhat den rssuperbmobileswitch functionsasrendermode 2bis 20functioneventlegtnbspbildergalerie911 turbo s39n chipkiaeur 2000eur 75000 eurrenault legtnews test7renault legt denfahrberichtneuen abtmodelleeur 10000 eurpadding 0test nochschon getunt abtalle 500 eurkfzversicherungvideosliderbusy truecursorrichtigen39n chip draufadacstauprognoselabelmacancayennesasrendermode 2 saspageiduumlbermithaltenhateur 25000li xdrive v12functionevent sasrendermode 2hat dencrvmazda cx5renault koleos9000 eur 10000halodesignsmediaposterjaguar ftypesastargetsantaabspielen video bmwformelsommerreifenplusmediaplayerdataloaderaddtransformatorfunction data nextrenaultepagex5 uumlberarbeitetimageoverlayinabtdas goldenereturngetunt abt hatohnehin schon teuresautos dermazdatop7ergeflochtene carbonraumlderquotflugstundequot imbisreifen15000 euroalle neueneur 9000 eureur 8000 eurzurmondeolaumluft kommtdie aktuellewird1 bildergaleriefelgenquotflugstundequot im top7er37wertbaseactionnissanmodellso kommt derbeitraumlge imimif typeofden koleos neudetailactionfrisch aufohnehin schonturbo sder sommerpauseeinvideo kofferraumgolfsuvauf demwegdelaytimesmartadserverajaxsaspageidsasformatidsastarget if typeofmarktabspielen video2017 dievideohighlight slider4slider teaserrichtigen werteur 20000 eureur 17500vw trocvideosliderstartpositionim extremsprintuumlberblickmotorsportcombi der lademeistervideotextauto leichtmithalten renaulttypeof sascalladdraufpadding 0 02314simpelmachenmarkoauf vettelbmw z4 conceptneu aufnicht2017 mitfahrtneuerzuxdrive v12 imkann dervettelv12eur 2500 eurwohnmobiltest12500 eur 15000tourer 2017machen einfuumlreurosaspageid 10017homegaqvideo porsche 91118 bis 20ruumlckreisewellefrischparseintvideosliderwrappercssmarginleftreplacepxsonderausstattunggegen mazdazweiauto bild zeigtgetunt abtfahrzeugbewertungden richtigenrallye911 turbosasrendermodemobile ansichtkickereur 2000 eurmaxsich derps frischso kommtdes jahres 2017videosliderbusyformat1 bildergalerie halodesignsdie aktuelle adacstauprognoseporsche 911 turboeur 4000abtmodelle uumlbersichtder neuehalodesigns so2gelassenheit an dienextdatafunctionevent sasrendermodesportsline modelluumlberblick abtthemaautofahren auf gelassenheit11der lademeister videoinsignia sports tourerkann der koleoskaufenfieldgibt eswohnmobile simpelbeispiel im testvideos1000 eur 1500zumampasstim uumlberblickeur 3000turboexclusive geflochteneistmodelluumlberblick abtbis zuthemen510 pschipnochgoldene lenkrad 2017die ruumlckreisewellestauprognose diecontenteur 7000noch imim test quotflugstundequotzum themaconnectedsuperteuren luxusrennersuperteureaktuellekompakteformel 1 bildergaleriefuumlr dendaif videosliderstartmargin marginleftlivestreamtrysupersportwagen preis fuumlrhonda0 videohighlightmit 500setzt aufsuperb combigetuntkofferraum fordli xdrivehierimgfunction varhomepagemediaplayerhyundai santa fesportsline modelluumlberblicktrockmhteaser25000 eur 30000axel springerneuzulassungenwohnmobiltest der fabelhafteeur 40000thissetgaeventonlinkwithdelayvideohighlightnexttbooleanm760 li xdriveturnier das passt6000 eur 7000leftsuvdemtwitterbottomofwindowsmartadserversaspageidsasformatidsastargetbeimbildergalerie halodesignscallgaevent2video kofferraum skodamediaplayerdataloaderaddtransformatorfunctiontestideale zweitwohnsitzalle beitraumlgetrue6000 eurder cockpitschutz aussehennderungmalibu t 41019sicherheit0videohighlightim augustbestekommt escombidem marktpanamera36vorschaustaumlrkerauf und erwartetrecarosimpel und guumlnstig7pxvom 18 biseur 4000 eur202500 eureventdrehtsupercarsnorepeat2 saspageidhonda crvmazdasaspageid 10017home sasformatid300x100 sastargetviel platzdas goldene lenkradfunction imageoverlayoutgalabeldodgemit 510seat2018 erlkoumlnigrightmehr zumfuumlr 15000 euro7000 eur 8000xdrive v12crvvideo abspielen videoaugust beim autofahren300x100im test gegenlaumluft kommt estargetingschon teureswerdeniaa8test ratgeberbackground20pxalle themen4sim neuenaudi etron quattroracechip panamera 4sdesmodelle17500 eur 20000goldenemuss9kofferraum skodaweitereaxelnach der3000 eur 4000supersportleraucheur 1500 eur225abt hat denbmw z4zum superteuren25000 eurguumlnstigeguumlnstige camperformel 1 markoteureswiedermodelgebrauchtwagensaspageidkoumlnnte der cockpitschutzder cockpitschutzpreis fuumlr sonderausstattungfuumlr sonderausstattungquotflugstundequotsupersportwagen preiscolorvar mobileswitchabt rs5 mit75000 eur 100000noch 39nbeispiel imthemen news testfacebooknoch im augustshow functionevent sasrendermodespringersastarget targeting smartadserversaspageidsasformatidsastargetendfnrs5 mitlenkrad 2017newporscheshowconcept 2017autovideoeur 10000010pxs exclusivevideo kofferraum fordder fabelhafte winnecatoden rs 52000 eurlademeister videobid5922dauertestvideo bmwgelassenheitactualnumbereur 6000emacanerfolge zum beispielaudieur 75000die erstendirection5000 euraktuelle stauprognose diediesel testhinweiscolor fff videohighlightpremiere nochtouchend endfnabtmodelleallradkoumlnntenextsecondlaumluft weil diezum beispiel imstauprognoseim testein ohnehinerwartet erfolge zumweil dietest gegen mazdaurltofolloweur 5000 eurgebrauchtwagenmarktmotor showeinegwmhmteures autohalodesigns so koumlnnteabtmodelle uumlbersicht abtruumlckreisewelle laumlufttest noch 39nkia cee39dalle neuen abtmodelleracechip panameraden rsracechipt3setcustomvarmobileswitchmobilebrowsersfixedpositioneur 9000reisemobilsportsteures auto leichtansichteur 50000 eurcontinentalteilnehmernoch 39n chipskoda28autobilddeactionmobilansichtdentest fahrberichtplayeridcayenne 2017setztsaspageid10017home seite autobilddehomeimageoverlayout9000 eur40000 eurcarbonraumlderleicht zumbeispielbid5922 smartadserverajaxsaspageidsasformatidsastargetetron quattrovideosliderthreshold falsecockpitschutz aussehenabt sportsline modelluumlberblickeur 7000 euruumlbersicht2000 eur 2500platz imturnier daserlkoumlnigsaspageid10017homeruumlckreisewelle laumluft weilweilmarkensuperteuren luxusrenner superteureeur 40000 eurgegenkoleos jetzt mithaltenweil die ruumlckreisewellelademeister video abspielensports tourer 2017koleos jetztmalibueur 12500 eurauf dem marktsearchbar formblockwinnebagowinnecatoexclusive geflochtene carbonraumldervideosliderboxwidthvideosliderendposition2018 erstefffparamratgeberz4 concept1 marko setzteoriginaleventtouchesbmw m760 lisupersportwagenpasst in densuvsidealepaddingsearchbar10017home sasformatidlademeistersuperteuren4000 eur 5000smartadserverajaxsaspageidsasformatidsastargetsascalladfindenkoleos testuumlberarbeitet plusgewinnenalskommt der neue4s diesel testfunctiones vomnoneaktuelle adacstauprognosestepssascalladsasformatideoriginaleventtouches eoriginaleventtouches0pagexlaumluft weileur 17500 eursindcx5renault koleos testthemen newsplus allebringtleicht zum superteurenopel insignia sportsstarseinen18margintopfontsizeluxusrenneraufalle beitraumlge imjetztsastarget targeting

Longtail Keyword Density for Autobild.de

KeywordsOccurences
video abspielen video38
mehr zum thema11
911 turbo s9
porsche 911 turbo9
abspielen video kofferraum9
insignia sports tourer7
turbo s exclusive7
seite autobilddehome pageid740166
video porsche 9116
abspielen video porsche5
malibu t 4105
alle beitraumlge im5
kofferraum opel insignia5
noch im august5
saspageid10017home seite autobilddehome5
beitraumlge im uumlberblick5
das goldene lenkrad5
audi e-tron quattro5
video kofferraum opel5
e-tron quattro 20185
opel insignia sports5
der fabelhafte winnecato4
travato wohnmobil-test der4
500 eur 10004
winnebago travato wohnmobil-test4
eur 1000 eur4
wohnmobil-test der fabelhafte4
zum superteuren luxus-renner4
schon teures auto4
ohnehin schon teures4
ein ohnehin schon4
teures auto leicht4
leicht zum superteuren4
auto leicht zum4
1000 eur 15004
25000 eur 300004
auto bild zeigt4
ausstattungs-extras machen ein4
eur 75000 eur4
75000 eur 1000004
eur 100000 eur4
die ruumlckreisewelle laumluft4
50000 eur 750004
eur 50000 eur4
30000 eur 400004
eur 30000 eur4
marko setzt auf4
eur 40000 eur4
40000 eur 500004
alle 500 eur4
machen ein ohnehin4
eur 17500 eur4
15000 eur 175004
koleos jetzt mithalten4
der koleos jetzt4
kann der koleos4
eur 15000 eur4
sastarget targeting smartadserversaspageidsasformatidsastarget4
euro ausstattungs-extras machen4
eur 12500 eur4
12500 eur 150004
300x100 sastarget targeting4
test kann der4
koleos test kann4
20000 eur 250004
mediaplayerdataloaderaddtransformatorfunction data next4
eur 25000 eur4
alle themen news4
themen news test4
eur 20000 eur4
17500 eur 200004
cx-5renault koleos test4
cr-vmazda cx-5renault koleos4
honda cr-vmazda cx-5renault4
color fff videohighlight4
eur 10000 eur4
10000 eur 125004
eur 2500 eur4
2500 eur 30004
eur 3000 eur4
9000 eur 100004
2000 eur 25004
eur 2000 eur4
15000 euro ausstattungs-extras4
fuumlr 15000 euro4
eur 1500 eur4
1500 eur 20004
eur 4000 eur4
3000 eur 40004
4000 eur 50004
eur 9000 eur4
8000 eur 90004
7000 eur 80004
eur 7000 eur4
6000 eur 70004
5000 eur 60004
eur 6000 eur4
eur 8000 eur4
panamera 4s diesel4
eur 5000 eur4
premiere noch im3
supersportwagen preis fuumlr3
preis fuumlr sonderausstattung3
porsche cayenne 20173
cayenne 2017 mitfahrt3
es vom 183
den rs 53
hat den rs3
rs 5 uumlberarbeitet3
5 uumlberarbeitet plus3
uumlberarbeitet plus alle3
abt hat den3
getunt abt hat3
frisch auf dem3
auf dem markt3
markt und schon3
schon getunt abt3
plus alle neuen3
alle neuen abt-modelle3
padding 0 03
mit 500 ps3
abspielen video bmw3
eoriginaleventtouches eoriginaleventtouches0pagex epagex3
if videosliderstartmargin marginleft3
kommt der neue3
so kommt der3
neuen abt-modelle uumlbersicht3
abt-modelle uumlbersicht abt3
uumlbersicht abt sportsline3
tokyo motor show3
ps frisch auf3
510 ps frisch3
vom 18 bis3
kommt es vom3
18 bis 203
bis 20 august3
20 august beim3
laumluft kommt es3
ruumlckreisewelle laumluft kommt3
aktuelle stauprognose die3
ruumlckreisewelle laumluft weil3
laumluft weil die3
weil die ruumlckreisewelle3
august beim autofahren3
beim autofahren auf3
modelluumlberblick abt rs-53
sportsline modelluumlberblick abt3
abt rs-5 mit3
rs-5 mit 5103
mit 510 ps3
abt sportsline modelluumlberblick3
simpel und guumlnstig3
autofahren auf gelassenheit3
gelassenheit an die3
die aktuelle adac-stauprognose3
der ideale zweitwohnsitz3
staumeldungen aktuelle stauprognose3
0 searchbar formblock3
diesel test noch3
test noch 39n3
noch 39n chip3
39n chip drauf3
4s diesel test3
racechip panamera 4s3
test gegen mazda3
gegen mazda cx-53
cx-5 und honda3
bmw m760 li3
m760 li xdrive3
quotflugstundequot im top-7er3
superteuren luxus-renner superteure3
luxus-renner superteure sonderausstattung3
formel 1 bildergalerie3
test quotflugstundequot im3
im test quotflugstundequot3
li xdrive v123
xdrive v12 im3
v12 im test3
im test gegen3
beispiel im test3
bid5922 smartadserverajaxsaspageidsasformatidsastarget if3
smartadserverajaxsaspageidsasformatidsastarget if typeof3
if typeof sascallad3
typeof sascallad undefined3
sastarget bid5922 smartadserverajaxsaspageidsasformatidsastarget3
saspageid 10017home sasformatid3
functionevent sasrendermode 23
sasrendermode 2 saspageid3
2 saspageid 10017home3
jetzt mithalten renault3
mithalten renault legt3
erwartet erfolge zum3
erfolge zum beispiel3
zum beispiel im3
auf und erwartet3
koleos neu auf3
renault legt den3
legt den koleos3
den koleos neu3
1 bildergalerie halo-designs3
bildergalerie halo-designs so3
combi der lademeister3
der lademeister video3
lademeister video abspielen3
video kofferraum ford3
superb combi der3
skoda superb combi3
sports tourer 20173
video kofferraum skoda3
kofferraum skoda superb3
kofferraum ford mondeo3
ford mondeo turnier3
z4 concept 20173
mittelklasse-kombis im check3
show functionevent sasrendermode3
bmw z4 concept3
hyundai santa fe3
mondeo turnier das3
turnier das passt3
passt in den3
im neuen insignia3
platz im neuen3
1 marko setzt3
setzt auf vettel3
auf vettel vettel3
vettel vettel staumlrker3
formel 1 marko3
der cockpitschutz aussehen3
halo-designs so koumlnnte3
so koumlnnte der3
koumlnnte der cockpitschutz3
vettel staumlrker nach3
staumlrker nach der3
s exclusive geflochtene3
exclusive geflochtene carbon-raumlder3
viel platz im3
goldene lenkrad 20173
des jahres 20173
nach der sommerpause3
auto bild reisemobil3
den richtigen wert3
searchbar formblock field3
abspielen video38
video abspielen38
auto bild24
mehr zum11
video kofferraum11
zum thema11
im test10
porsche 91110
alle themen9
turbo s9
911 turbo9
formel 18
video porsche7
insignia sports7
s exclusive7
im uumlberblick7
bmw z47
e-tron quattro7
searchbar formblock7
sports tourer7
ruumlckreisewelle laumluft6
0 06
abt sportsline6
autobilddehome pageid740166
concept z46
mit dem6
porsche cayenne6
opel insignia6
sastarget targeting6
seite autobilddehome6
t 4105
2018 erlkoumlnig5
quattro 20185
wohnmobil-test der5
winnebago travato5
gwmhm teaser5
der neue5
audi e-tron5
beitraumlge im5
goldene lenkrad5
das goldene5
fuumlr die5
supersportler im5
noch im5
alle beitraumlge5
im august5
padding 05
malibu t5
function var5
kofferraum opel5
fff videohighlight5
bis zu5
panamera 4s5
saspageid10017home seite5
gibt es5
6000 eur4
eur 60004
eur 50004
eur 40004
4000 eur4
5000 eur4
eur 80004
mobile ansicht4
eur 100004
10000 eur4
eur 125004
9000 eur4
eur 90004
7000 eur4
param jquery4
8000 eur4
eur 70004
vw golf4
eur 20004
2000 eur4
alle 5004
1500 eur4
eur 15004
eur 10004
1000 eur4
12500 eur4
2500 eur4
vw t-roc4
500 eur4
bild zeigt4
concept 20174
eur 30004
3000 eur4
if typeof4
eur 300004
margin 04
0 videohighlight4
videohighlight slider4
color fff4
targeting smartadserversaspageidsasformatidsastarget4
300x100 sastarget4
der fabelhafte4
fabelhafte winnecato4
rs 54
videohighlight videotext4
videohighlight share4
eoriginaleventtouches0pagex epagex4
themen news4
news test4
data next4
mediaplayerdataloaderaddtransformatorfunction data4
video bmw4
fuumlr den4
nderung der4
travato wohnmobil-test4
die ruumlckreisewelle4
eur 250004
25000 eur4
var mobileswitch4
30000 eur4
20000 eur4
eur 200004
15000 eur4
eur 175004
17500 eur4
eur 400004
40000 eur4
100000 eur4
saspageid 10017home4
erlkoumlnig audi4
eur 1000004
75000 eur4
eur 500004
50000 eur4
eur 750004
eur 150004
eur 25004
jetzt mithalten4
koleos jetzt4
nach der4
setzt auf4
superteure sonderausstattung4
marko setzt4
lenkrad 20174
der koleos4
cx-5renault koleos4
cr-vmazda cx-5renault4
koleos test4
test kann4
kann der4
superteuren luxus-renner4
zum superteuren4
euro ausstattungs-extras4
ausstattungs-extras machen4
15000 euro4
fuumlr sonderausstattung4
im vergleich4
4s diesel4
machen ein4
ein ohnehin4
auto leicht4
leicht zum4
teures auto4
schon teures4
ohnehin schon4
honda cr-vmazda4
fuumlr 150004
schon getunt3
getunt abt3
abt hat3
hat den3
dem markt3
auf dem3
mit 5103
510 ps3
ps frisch3
frisch auf3
den rs3
bmw m7603
abt-modelle uumlbersicht3
uumlbersicht abt3
im extremsprint3
tokyo motor3
neuen abt-modelle3
alle neuen3
5 uumlberarbeitet3
uumlberarbeitet plus3
plus alle3
rs-5 mit3
abt rs-53
aktuelle adac-stauprognose3
im top-7er3
quotflugstundequot im3
test quotflugstundequot3
die aktuelle3
auf gelassenheit3
august beim3
beim autofahren3
autofahren auf3
der ideale3
ideale zweitwohnsitz3
guumlnstige camper3
sasrendermode 23
sportsline modelluumlberblick3
modelluumlberblick abt3
wohnmobile simpel3
m760 li3
v12 im3
xdrive v123
li xdrive3
motor show3
chip drauf3
neu auf3
touchend endfn3
videosliderbusy true3
if videosliderstartmargin3
eoriginaleventtouches eoriginaleventtouches0pagex3
videosliderthreshold false3
zum beispiel3
erfolge zum3
erwartet erfolge3
videosliderstartmargin marginleft3
videosliderwrappercssmargin-left marginleft3
koleos neu3
den koleos3
test ratgeber3
axel springer3
var element3
if bottomofwindow3
marginleft parseintvideosliderwrappercssmarginleftreplacepx3
param string3
show functionevent3
beispiel im3
neuer elektro-bmw3
500 ps3
test noch3
diesel test3
media-poster buttonmedia-playbefore3
mit 5003
noch 39n3
39n chip3
so kommt3
kommt der3
kofferraum ford3
racechip panamera3
gegen mazda3
slider teaser3
test gegen3
renault legt3
0 20px3
functionevent sasrendermode3
lademeister video3
honda cr-v3
mazda cx-53
20 august3
bis 203
jahres 20173
des jahres3
2017 die3
richtigen wert3
im neuen3
2017 jaguar3
santa fe3
hyundai santa3
platz im3
jaguar f-type3
den richtigen3
bild reisemobil3
vettel staumlrker3
vettel vettel3
auf vettel3
typeof sascallad3
staumlrker nach3
kofferraum skoda3
neuen insignia3
tourer 20173
der sommerpause3
legt den3
2017 vorschau3
sasformatid sascalladsasformatid3
connected car3
bid5922 smartadserverajaxsaspageidsasformatidsastarget3
sastarget bid59223
die neue3
function imageoverlayout3
mittelklasse-kombis im3
im check3
2018 erste3
padding 10px3
10017home sasformatid3
exclusive geflochtene3
viel platz3
z4 concept3
smartadserverajaxsaspageidsasformatidsastarget if3
geflochtene carbon-raumlder3
test fahrbericht3
0 searchbar3
formblock field3
alle marken3
sascallad undefined3
1 marko3
der lademeister3
ford mondeo3
kia cee39d3
staumeldungen aktuelle3
mondeo turnier3
turnier das3
zur mobilansicht3
den mondeo3
das passt3
aktuelle stauprognose3
stauprognose die3
kommt es3
es vom3
vom 183
18 bis3
laumluft kommt3
autos der3
2 saspageid3
laumluft weil3
weil die3
combi der3
mobileswitch function3
bildergalerie halo-designs3
1 bildergalerie3
mithalten renault3
data action3
halo-designs so3
so koumlnnte3
cockpitschutz aussehen3
der cockpitschutz3
koumlnnte der3
luxus-renner superteure3
skoda superb3
preis fuumlr3
cayenne 20173
2017 mitfahrt3
premiere noch3
supersportwagen preis3
superb combi3
sich der3
mobilansicht der3
auf die3
die ersten3
eur92
der84
video83
var79
die62
im60
function46
041
abspielen38
auto37
videohighlight37
135
alle35
if34
test32
mit30
auf29
zum29
bmw28
bis27
bild26
den25
ein24
fuumlr23
porsche22
222
von21
das19
audi18
true18
s16
ratgeber16
es15
mehr15
314
sie14
z414
414
autos13
teaser13
kmh13
so13
false13
zu13
abt12
marginleft12
noch12
ps12
vw12
neue12
none12
kofferraum11
euro11
insignia11
slider11
des11
padding11
mobileswitch11
return11
param11
concept11
koleos11
thema11
neuen10
show10
news10
themen10
font-size10
dem10
sich10
weitere10
seite10
opel10
510
tuning10
erlkoumlnig10
gibt9
august9
20px9
cayenne9
turbo9
sastarget9
sonderausstattung9
vettel9
gwmhm9
element9
nach9
kommt9
preis8
formel8
tourer8
68
einen8
werden8
t-roc8
bei8
ist8
premiere8
searchbar8
uumlberblick8
nicht8
data8
title8
schon8
malibu8
cursor8
mazda8
wohnmobil-test8
target8
hyundai8
78
honda8
next7
videos7
jquery7
sportscars7
hier7
nbsp7
hat7
zeigt7
kicker7
ford7
wohnmobile7
detailaction7
jaguar7
vom7
videosliderbusy7
golf7
sports7
sasformatid7
direction7
schliessen7
87
kann7
nextfirst7
e-tron7
exclusive7
neu7
formblock7
quattro7
videosliderboxwidth7
als6
color6
marken6
share6
skoda6
videosliderthreshold6
96
mondeo6
deactivatelinkcheck6
top6
diese6
nextsecond6
lenkrad6
reisemobil6
delaytime6
gewinnen6
else6
zur6
neuwagen6
pageid740166
format6
autobilddehome6
ruumlckreisewelle6
erste6
laumluft6
aktuelle6
markt6
supersportler6
margin-left6
line-height6
diesel6
targeting6
t6
marko6
kia6
sportsline6
livestream6
vorschau6
winnebago6
105
wird5
videosliderendposition5
url5
parseintvideosliderwrappercssmarginleftreplacepx5
ersten5
videosliderstartmargin5
uumlber5
mobile5
115
125
wenn5
135
145
155
steps5
width5
10px5
neuer5
165
fff5
action5
175
185
check5
saspageid10017home5
uumlbersicht5
galabel5
background5
guumlnstige5
details5
travato5
actualnumber5
beitraumlge5
iaa5
window5
bottomofwindow5
undefined5
mobilansicht5
panamera5
goldene5
racechip5
4s5
camper5
motorsport5
kaufen5
gebrauchtwagen5
klassik5
smartadserverajaxsaspageidsasformatidsastarget5
auch5
renault5
vergleich5
automarkt5
viel5
cockpitschutz5
new5
jetzt5
kompakte5
194
204
214
224
234
superteure4
244
254
homepagemediaplayer4
264
messen4
callgaevent24
superteuren4
274
felgen4
machen4
ausstattungs-extras4
284
ohnehin4
teures4
294
304
314
cx-5renault4
marke4
luxus-renner4
margin4
winnecato4
recaro4
fabelhafte4
324
wie4
gegen4
simpel4
cr-vmazda4
dreht4
rs4
mithalten4
300x1004
smartadserversaspageidsasformatidsastarget4
kaufberatung4
suvs4
ab4
seat4
videotext4
immer4
334
344
cabrio4
x4
nissan4
img4
fahrbericht4
bringt4
headline4
354
leicht4
eoriginaleventtouches0pagex4
volkswagen4
epagex4
saspageid4
gebrauchtwagenmarkt4
eoriginaleventtouches4
sommerreifen4
ansicht4
videosliderclicking4
rallye4
10017home4
stars4
sasrendermode4
bottomofelement4
label4
functionevent4
erlkoumlnige4
toyota4
click4
gaq4
touchend4
playerid4
finden4
koreaner4
typeof4
wert4
nderung4
left4
bilder4
amp4
reifen4
nextdata4
viper4
setzt4
urltofollow4
mercedes4
sind4
aus4
mediaplayerdataloaderaddtransformatorfunction4
durch4
364
target23
einfache3
skurrile3
extremsprint3
dauertest3
gaaction3
muss3
anzeige3
vs3
am3
olsson3
motor3
tokyo3
bitte3
selector3
axel3
e-macan3
teilnehmer3
try3
springer3
weg3
teuer3
dauertester3
welche3
autobildde3
boxer-motor3
t3setcustomvar3
buttonmedia-playbefore3
max3
facebook3
sascalladsasformatid3
sascallad3
allrad3
bid59223
getjson13
baseaction3
plugins3
event3
thissetgaeventonlinkwithdelayvideohighlight3
373
text3
twitter3
elektro-bmw3
videosliderstartposition3
content3
touchx3
endfn3
videosliderwrappercssmargin-left3
pictureblock3
string3
border3
position3
mediaplayerdata-themeautobild3
connected3
right3
slidercontent3
car3
media-poster3
height3
7px3
macan3
zwei3
luftdruck3
santa3
fe3
modelle3
richtigen3
vor3
neuwagenkonfigurator3
fahrzeugbewertung3
wieder3
suchen3
bauen3
kastenwagen3
no-repeat3
staumlrker3
imageoverlayout3
dodge3
saison3
aussehen3
imageoverlayin3
sommerpause3
sicherheit3
mittelklasse-kombis3
golf-suv3
kfz-versicherung3
fahren3
supercars3
eine3
combi3
superb3
platz3
nur3
lademeister3
turnier3
mobileswitchmobilebrowsersfixedposition3
hinweis3
mobilefixed3
passt3
isandroidcrome3
carbon-raumlder3
geflochtene3
stories3
klassiker3
beste3
jahres3
aktionen3
hostname3
boolean3
checker3
thisavailable3
number3
f-type3
koumlnnte3
halo-designs3
cr-v3
adac-stauprognose3
cx-53
ideale3
zweitwohnsitz3
gelassenheit3
autofahren3
staumeldungen3
infos3
stauprognose3
weil3
beim3
beispiel3
erfolge3
frisch3
383
getunt3
uumlberarbeitet3
plus3
rs-53
modelluumlberblick3
guumlnstig3
erwartet3
da3
legt3
cee39d3
suv3
blitzer3
continental3
quotflugstundequot3
radarfallen3
supercar-crash3
top-7er3
neuzulassungen3
bildergalerie3
field3
margin-top3
modell3
v123
power3
drauf3
m7603
model3
chip3
39n3
li3
xdrive3
haben3
supersportwagen3
dtm3
mitfahrt3
abt-modelle3

What are the nameservers for autobild.de?

Autobild.de Domain Nameserver Information

HostIP AddressCountry
ns1.netuse.de 195.244.244.10Germany Germany
ns2.netuse.de 195.244.235.10Germany Germany
ns4.netuse.de 212.12.39.198Germany Germany

Autobild.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Autobild.de is a scam?