Windshield Replacement Phoenix - A+ & Up to $150 Back

Safety: Low trust score
Year Founded: 2013
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-02
Category: This site has not been categorized yet

Get up to $150 back with any windshield replacement Phoenix. Guaranteed lowest cash price for your windshield repair.


Domain summary

Domain label
autoglassrepairphoenixaz
Domain extension
net
Domain registered:
2013-08-22
Domain updated:
2020-08-23
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is autoglassrepairphoenixaz.net ranked relative to other sites:

Percentage of visits to autoglassrepairphoenixaz.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Autoglassrepairphoenixaz.net registered?
A: Autoglassrepairphoenixaz.net was registered 7 years, 6 months, 2 weeks, 2 days, 8 hours, 2 minutes ago on Thursday, August 22, 2013.
Q: When was the WHOIS for Autoglassrepairphoenixaz.net last updated?
A: The WHOIS entry was last updated 6 months, 2 weeks, 1 day, 8 hours, 2 minutes ago on Sunday, August 23, 2020.
Q: What are Autoglassrepairphoenixaz.net's nameservers?
A: DNS for Autoglassrepairphoenixaz.net is provided by the following nameservers:
  • dns.site5.com
  • dns2.site5.com
Q: Who is the registrar for the Autoglassrepairphoenixaz.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Autoglassrepairphoenixaz.net?
A: Autoglassrepairphoenixaz.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Autoglassrepairphoenixaz.net each day?
A: Autoglassrepairphoenixaz.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Autoglassrepairphoenixaz.net resolve to?
A: Autoglassrepairphoenixaz.net resolves to the IPv4 address 129.121.4.177.
Q: In what country are Autoglassrepairphoenixaz.net servers located in?
A: Autoglassrepairphoenixaz.net has servers located in the United States.
Q: What webserver software does Autoglassrepairphoenixaz.net use?
A: Autoglassrepairphoenixaz.net is powered by Nginx/1.14.0 webserver.
Q: Who hosts Autoglassrepairphoenixaz.net?
A: Autoglassrepairphoenixaz.net is hosted by Colo4, LLC in United States.
Q: How much is Autoglassrepairphoenixaz.net worth?
A: Autoglassrepairphoenixaz.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Autoglassrepairphoenixaz.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Autoglassrepairphoenixaz.net Free SEO Report

Website Inpage Analysis for Autoglassrepairphoenixaz.net

H1 Headings

1 :
  1. Dealer Auto Glass - Rated #1 For Windshield Replacement Phoenix and Phoenix Auto Glass Shop Near Me

H2 Headings

8 :
  1. Get Up to $150 Back with a Windshield Replacement
  2. Not sure if you have windshield repair coverage?
  3. Lifetime Repair & Replacement Warranty
  4. It's All About Our Customers
  5. Your Time Is Important
  6. Welcome to Dealer Auto Glass of Arizona
  7. Need Window Tinting?
  8. Windshield Replacement Phoenix News and Information

H3 Headings

17 :
  1. It's a Perfect Time to Fix Your Auto Glass Phoenix!
  2. Award Winning Replacement & Repair Service
  3. Not Sure What You Need?
  4. Expertise Matters
  5. What Customers Are Saying About Our Windshield Replacement Company
  6. Your Time Matters
  7. What Are You Waiting For? Now Is the Perfect Time!
  8. Quality Matters
  9. We are the Preferred Dealer for On Track Garage Door
  10. We are the Preferred Dealer for Preventive Pest Control
  11. We are the Preferred Dealer for SERVGROW Customers
  12. Special Offer from Express Movers
  13. Our Local Address
  14. Our Other Local Windshield Repair and Replacement Service Areas
  15. Best Decision You Will Ever Make
  16. Need a Temporary Broken Car Window Fix
  17. What Are You Waiting For? Now Is the Perfect Time!

H4 Headings

6 :
  1. A Quick Guide to Replacement & Repair in Arizona
  2. Ever Wonder What Windshields Are Made Of?
  3. How A Windshield Chip Can Lead To A Long Crack
  4. Your Questions Answered
  5. The Benefits of Mobile Replacement Companies
  6. Why You Should Get Your Windshield Repaired Quickly

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

3 :

Total Images

28 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-60350068-1

Links - Internal

20:

Links - Internal (nofollow)

0:

Links - Outbound

58:

Links - Outbound (nofollow)

0:

Keyword Cloud for Autoglassrepairphoenixaz.net

companiesreplacement warrantygaragehas beenauto glass companydealer autoyouimportantbeenour windshieldvehiclelifetimeperfect timereplacementphoenixhavemy windshieldarticle hereentire article hereread the entirepesttemporary6804557autotheyrepairquicklywindshield replacement phoenixinsurancequotehaswinningyour carbackperfectcardays a weekazservicestheirnotifpest controlamazingbroken car windowawardmobiledoorserviceschedule1 autoentirerepair or replacementmytechniciansdidgarage doorsuresame7 daysnowmeamppreferred dealerneedcanqualityarizonacheckcontrolpmfixlifetime warrantyevencustomersphoenix arizonabrokenvalleynations bestfix mygodaysyour vehiclecompanydamagedealer auto glasscomesdealerservgrowmoving3award winningyourheregoingbroken car1ammovers602 6804557bestupensureyour windshieldrepair and replacementmatterswindshield replacement1 auto glassareasif you2crackdrivingyearstintingwhywewindshieldgetwindowsitsouttimewindshield repairrockyour timeallweekover0quickanywhereglasslocalmesa azwarrantychipwindshieldsglass companyauto glassentire articlearticlewindowgreatguaranteednationsratedbackedwindow tintingsafetyreplacement phoenixreadcar windowmesapreferredour

Longtail Keyword Density for Autoglassrepairphoenixaz.net

KeywordsOccurences
dealer auto glass6
windshield replacement phoenix5
read the entire5
entire article here5
1 auto glass4
auto glass company4
days a week3
repair or replacement3
repair and replacement3
broken car window3
auto glass21
windshield repair9
window tinting8
windshield replacement8
your windshield6
dealer auto6
article here6
entire article5
lifetime warranty5
my windshield5
replacement phoenix5
your time5
602 680-45574
1 auto4
our windshield4
nations best4
fix my4
glass company4
your car3
garage door3
mesa az3
broken car3
pest control3
7 days3
preferred dealer3
phoenix arizona3
your vehicle3
perfect time3
award winning3
replacement warranty3
has been3
if you3
car window3
windshield40
replacement30
your30
you27
phoenix25
auto25
our25
repair24
glass24
service15
we14
my14
time14
dealer13
window13
arizona12
company11
warranty10
fix9
best9
here9
get8
tinting8
lifetime8
comes7
az7
car7
quality7
07
have6
if6
article6
all6
read6
not6
has6
can6
their6
safety5
out5
entire5
chip5
customers5
technicians5
now5
amp5
local5
matters4
great4
preferred4
need4
control4
moving4
me4
mesa4
schedule4
crack4
why4
mobile4
windshields4
years4
valley4
important4
services4
days4
14
24
680-45574
nations4
its4
sure3
back3
temporary3
windows3
up3
garage3
servgrow3
door3
pest3
quickly3
am3
rated3
pm3
quick3
quote3
even3
vehicle3
award3
33
amazing3
backed3
going3
ensure3
same3
companies3
week3
anywhere3
perfect3
areas3
over3
been3
driving3
movers3
guaranteed3
damage3
they3
go3
winning3
check3
insurance3
did3
rock3
broken3

Who hosts Autoglassrepairphoenixaz.net?

Autoglassrepairphoenixaz.net Hosting Provider Information

Hosted IP Address:129.121.4.177
Hosted Hostname:ip-129-121-4-177.local
Service Provider:Colo4, LLC
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:nginx/1.14.0

Is "Colo4, LLC" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
Colo4, LLC
0.4473%

HTTP Header Analysis for Autoglassrepairphoenixaz.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx/1.14.0
Date: Mon, 02 Nov 2020 04:35:45 GMT
Content-Type: text/html; charset=iso-8859-1
Content-Length: 242
Connection: keep-alive
Location: https://www.dealerautoglassaz.net/

Autoglassrepairphoenixaz.net Domain Nameserver Information

HostIP AddressCountry
dns.site5.com 162.210.50.254
dns2.site5.com 108.174.149.181


Need to find out who hosts Autoglassrepairphoenixaz.net?


Domain Registration (WhoIs) information for Autoglassrepairphoenixaz.net

 Domain Name: AUTOGLASSREPAIRPHOENIXAZ.NET
Registry Domain ID: 1823002258_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-08-23T17:44:30Z
Creation Date: 2013-08-22T14:41:33Z
Registrar Registration Expiration Date: 2020-08-22T14:41:33Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Diamond AG PHX
Registrant State/Province: Texas
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=AUTOGLASSREPAIRPHOENIXAZ.NET
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=AUTOGLASSREPAIRPHOENIXAZ.NET
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=AUTOGLASSREPAIRPHOENIXAZ.NET
Name Server: DNS.SITE5.COM
Name Server: DNS2.SITE5.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-05-12T01:00:00Z

Websites with Similar Names

Autog00d.ru
Главная страница - 716parts.ru
Autogain.net
AutoGain.net | Get 10 FREE Auto Transport Quotes & Save!
Autogajet.ru
????????????? ????????????????? Blackview| ??????????.?? - ????????????? ????????????????? Blackview ????? ? ? ???????
Autogal.com
The domain name AUTOGAL.COM is for sale
Autogala.pl
Autogala
Autogalactic.com
autogalactic.com has expired
Autogalaktika.ua
Autogalaktika - Продажа новых и подержанных авто в Украине. Куплю машину в Николаеве (Авторынок). Подержанные автомобили (б/у).
Autogalant.com
HugeDomains.com - Shop for over 300,000 Premium Domains

Recently Updated Websites

Humanssupporthumans.com (1 second ago.)Randki4sex.com (1 second ago.)Starlinkacademy.com (2 seconds ago.)Sinogreatsc.com (2 seconds ago.)Dbqcomputerservices.com (2 seconds ago.)Communitygardeners.ru (2 seconds ago.)Corenatural.com (3 seconds ago.)Pocketholler.com (3 seconds ago.)Schultzpp.com (3 seconds ago.)Baxx.uk (3 seconds ago.)Samanthafairuz.com (3 seconds ago.)Uvay.club (4 seconds ago.)Blumot.biz (4 seconds ago.)Vite.net (4 seconds ago.)Freecovidfacecovering.com (5 seconds ago.)Cssquared.club (5 seconds ago.)Oliviajosh.com (6 seconds ago.)Lovelightroompresets.com (6 seconds ago.)Qayon.org (6 seconds ago.)Tangolandia.com (7 seconds ago.)Nationalrvwarranty.com (7 seconds ago.)Teamrocketgo.com (8 seconds ago.)Lindakampley.com (8 seconds ago.)Mygraduation.com (9 seconds ago.)Flourishpower.com (9 seconds ago.)Aoavip6455.com (9 seconds ago.)Luisfelipesouza.com (9 seconds ago.)Curraheenparish.com (9 seconds ago.)Qianmima.com (9 seconds ago.)Cw-ytool1r.work (10 seconds ago.)

Recently Searched Keywords

rewards history (1 second ago.)below (1 second ago.)furry pirn (2 seconds ago.)saukampus (3 seconds ago.)thesaabunwala (4 seconds ago.)flexpower camera (5 seconds ago.)shower chair (5 seconds ago.)cng nhau khi (6 seconds ago.)bayreuth (8 seconds ago.)htc b beats audio (9 seconds ago.)ab sofort (10 seconds ago.)caselor din lemn (11 seconds ago.)centerborder-color000000border-stylesolidmedia (11 seconds ago.)1px (13 seconds ago.)pleasure boat (15 seconds ago.)851pxmedia (16 seconds ago.)750mg cbn (18 seconds ago.)werewolf, vampire, or human test (19 seconds ago.)supportreckeen 3d (19 seconds ago.)stream tv (20 seconds ago.)the lesbian, gay, bisexual & transgender community center (the center) (22 seconds ago.)plou (22 seconds ago.)le 12 (23 seconds ago.)mostrar carrito (23 seconds ago.)domainhotelli oy (24 seconds ago.)stackpath (25 seconds ago.)delcampe banknotes (25 seconds ago.)azgın seksi kızlar (27 seconds ago.)saginaw (28 seconds ago.)srclink srclink (28 seconds ago.)