Ayurvedic Treatment Centres in Kerala & Chennai | AVA Care | Buy Natural Food Products Online

Safety: Low trust score
Year Founded: 2012
Global Traffic Rank: 639,874
Estimated Worth: $8,640
Category: This site has not been categorized yet



Domain summary

Last updated
2021-03-07
Domain label
avacare
Domain extension
in
Domain registered:
2012-06-28
Domain updated:
2021-03-07
Global Traffic Rank
639,874
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$8,640
Estimated daily income
$24
Estimated monthly income
$730

Frequently Asked Questions (FAQ)

Q: When was Avacare.in registered?
A: Avacare.in was registered 9 years, 2 months, 3 weeks, 2 days, 20 hours, 59 minutes, 33 seconds ago on Thursday, June 28, 2012.
Q: When was the WHOIS for Avacare.in last updated?
A: The WHOIS entry was last updated 6 months, 2 weeks, 20 hours, 59 minutes, 33 seconds ago on Sunday, March 7, 2021.
Q: What are Avacare.in's nameservers?
A: DNS for Avacare.in is provided by the following nameservers:
  • ns1.webindia.com
  • ns2.webindia.com
Q: Who is the registrar for the Avacare.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Avacare.in?
A: Avacare.in ranks 639,874 globally on Alexa. Avacare.in has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Avacare.in each day?
A: Avacare.in receives approximately 2,672 visitors and 8,016 page impressions per day.
Q: What IP address does Avacare.in resolve to?
A: Avacare.in resolves to the IPv4 address 172.104.167.146.
Q: In what country are Avacare.in servers located in?
A: Avacare.in has servers located in the Singapore.
Q: What webserver software does Avacare.in use?
A: Avacare.in is powered by Nginx/1.10.3 (Ubuntu) webserver.
Q: Who hosts Avacare.in?
A: Avacare.in is hosted by Cipherkey Exchange Corp. in Singapore, Singapore, 18.
Q: How much is Avacare.in worth?
A: Avacare.in has an estimated worth of $8,640. An average daily income of approximately $24, which is roughly $730 per month.

Avacare.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Avacare.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Avacare.in

H1 Headings

0 :

H2 Headings

3 :
  1. WELCOME TO THE AVA CARE ONLINE STORE!
  2. Sanjeevanam Ayurveda
  3. Subscribe to our Newsletter

H3 Headings

0 :

H4 Headings

99 :
  1. Sanjeevanam
  2. Kaytra
  3. Melam
  4. Pure Spices Previous Next
  5. Chilli Powder
  6. Coriander Powder
  7. Turmeric Powder
  8. Kashmiri Chilli Powder
  9. Black Pepper Powder
  10. Crushed Chilli
  11. Fennel Powder
  12. Cumin Powder
  13. Fenugreek Powder
  14. Everyday Masala Previous Next
  15. Chicken Masala
  16. Mutton Masala
  17. Meat Masala
  18. Fish Fry Masala
  19. Tandoori Masala
  20. Egg Curry / Roast Masala
  21. Fish Masala
  22. Garam Masala
  23. Vegetable Masala
  24. Breakfast Mix Previous Next
  25. Puttu Podi
  26. Appam/Idiappam Podi
  27. Roasted Rava
  28. Chemba Puttu Podi
  29. Rice Powder
  30. Dosa Mix
  31. Idli Mix
  32. Easy Palappam Podi
  33. Pathiri Podi
  34. Traditional Pickle Previous Next
  35. Lime Pickle
  36. Mango Pickle
  37. Tender mango Pickle
  38. Garlic Pickle
  39. Kadu mango Pickle
  40. Ginger Pickle
  41. White lime Pickle
  42. Gooseberry Pickle
  43. Fish Pickle
  44. Prawn Pickle
  45. Hair Care Previous Next
  46. KAYTRA Shampoo For Treated Hair
  47. KAYTRA SHAMPOO For Frizzy Hair
  48. KAYTRA Hair Oil
  49. KAYTRA Hair Pack
  50. KAYTRA Revitalising hair cream
  51. Traditional Masala - Kerala Previous Next
  52. Varutharacha Kozhi Curry
  53. Kadala Curry
  54. Meen Vattichathu
  55. Naadan Rasam
  56. Alappuzha Meen Curry
  57. Kozhi Peralan
  58. Kozhikode Biriyani
  59. Erachi Ularthiyathu
  60. Kerala Sambar
  61. Malabar Erachi Curry
  62. Meen Pollichathu
  63. Thalassery Biriyani
  64. Traditional Masala - Tamil Nadu Previous Next
  65. Chettinad Kozhi Kuzhambhu
  66. Chicken 65
  67. Tamil Nadu Sambar
  68. Milagu Rasam
  69. Idli Sambar
  70. Ennai Kathirikkai Kuzhambu
  71. Madurai Mutton Kola Urundai
  72. Ambur Biriyani
  73. Rice and Powders Previous Next
  74. Bran Rice
  75. Aval (Red Rice Flakes)
  76. Amla Powder
  77. Whole Wheat Powder
  78. Ragi Powder
  79. Navara Rice Powder
  80. Navara Rice
  81. Bran Rice Powder
  82. Natural Beverages Previous Next
  83. Dhania Coffee
  84. Ginger Coffee
  85. Thulasi coffee
  86. Dahashanthi
  87. Natural Health Mix
  88. Natural Sweeteners Previous Next
  89. Palm candy
  90. Pure Honey
  91. Herbs & Honey
  92. Dates & Honey
  93. Palm Candy Powder
  94. COMPANY
  95. Brands
  96. POLICY INFO
  97. CONTACT US
  98. PAYMENT OPTIONS
  99. FOLLOW US

H5 Headings

160 :
  1. 100gms
  2. 29.00
  3. 100g
  4. 27.00
  5. 100g
  6. 25.00
  7. 100g
  8. 50.00
  9. 50g
  10. 70.00
  11. 100g
  12. 38.00
  13. 100g
  14. 38.00
  15. 100g
  16. 50.00
  17. 100g
  18. 25.00
  19. 100g
  20. 56.00
  21. 100g
  22. 56.00
  23. 100g
  24. 56.00
  25. 50g
  26. 30.00
  27. 100g
  28. 62.00
  29. 50g
  30. 30.00
  31. 50g
  32. 24.00
  33. 100g
  34. 95.00
  35. 100g
  36. 52.00
  37. 500g
  38. 54.00
  39. 500gms
  40. 53.00
  41. 500g
  42. 58.00
  43. 500gms
  44. 60.00
  45. 500gms
  46. 53.00
  47. 500gms
  48. 80.00
  49. 500gms
  50. 80.00
  51. 500g
  52. 60.00
  53. 1kg
  54. 94.00
  55. 400g
  56. 81.00
  57. 400g
  58. 81.00
  59. 400g
  60. 130.00
  61. 200gm
  62. 59.00
  63. 400g
  64. 85.00
  65. 200gm
  66. 75.00
  67. 400g
  68. 73.00
  69. 400g
  70. 74.00
  71. 400g
  72. 149.00
  73. 400g
  74. 199.00
  75. 230g
  76. 165.00
  77. 230g
  78. 140.00
  79. 132g
  80. 349.00
  81. 250g
  82. 250.00
  83. 100g
  84. 185.00
  85. 100g
  86. 60.00
  87. 100g
  88. 50.00
  89. 100g
  90. 50.00
  91. 100g
  92. 75.00
  93. 100g
  94. 55.00
  95. 100g
  96. 82.00
  97. 100g
  98. 75.00
  99. 100g
  100. 75.00
  101. 100g
  102. 50.00
  103. 100g
  104. 0.00
  105. 100g
  106. 60.00
  107. 100g
  108. 0.00
  109. 50g
  110. 36.00
  111. 50g
  112. 25.00
  113. 50g
  114. 25.00
  115. 50g
  116. 36.00
  117. 50g
  118. 25.00
  119. 50g
  120. 20.00
  121. 50g
  122. 35.00
  123. 100gms
  124. 75.00
  125. 500gms
  126. 60.00
  127. 500g
  128. 80.00
  129. 100g
  130. 100.00
  131. 1kg
  132. 60.00
  133. 500g
  134. 60.00
  135. 500g
  136. 80.00
  137. 500g
  138. 80.00
  139. 500g
  140. 60.00
  141. 100g
  142. 140.00
  143. 100g
  144. 200.00
  145. 100g
  146. 175.00
  147. 100g
  148. 200.00
  149. 500g
  150. 275.00
  151. 150g
  152. 180.00
  153. 500g
  154. 350.00
  155. 500g
  156. 400.00
  157. 450g
  158. 300.00
  159. 100g
  160. 200.00

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

110 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

276:

Links - Internal (nofollow)

0:

Links - Outbound

4:

Links - Outbound (nofollow)

0:

Keyword Cloud for Avacare.in

c100g 7500 buydocumentreadyfunctionstockstockquantity0weight100gprice200brandsanjeevanamcategorynatural5600 buy nowricehelpscolourpopularlyifphone alertplease entervar lastnamefibrestoggleicon100g 7500needscontainslimestockstockquantity0weight50gprice25brandmelamcategorytamilflavourfulbranpowderdescriptionthis melam packwholemadepanelgrouponshownbscollapsecookedredgunturuniquehandpickedunique keepevent5000 buy7500 buynextrasamurlfalse return truechecktimeslotvalfield20000 buy nowpreviousragialternative to sugarfamouspowdergivehygienically packedenterkozhivideocontentshow videoframeattrsrcvegetablearoma when youeasy palappamyou canshampoothulasimeat masala powder6seasonedpalappam podibreakfastspecially selectedhygienically500g 6000ifisemailemail alertenter validbiriyani5600 buypolicynow naturalvalid email returningredientcurryecommercereturn false returnoilreturn falseunique keep fresh7500 buy nowcontenturlkaytraavapageinnercontentouteronsubmitlistauthentic combinationallmango picklewe havevalidpowdered and hygienicallypalmreturn false ifisemailemailkeralainternationalright proportion7powder givesherbs have beenwheat powderkeep freshexoticmixpalappamamla powderpowder hasyour tastenaturalstockstockquantity0weight100gprice56brandmelamcategoryeverydaychickenalertplease enter phoneafterpointlet youpowdereddietarytechnology for lastingcolour and tasteemail returnvegetable masalahave been handpickedbrings to youhealthmealdeliciousbuy nowayurvedictandoori masalarichusingchillinavaraothersanjeevanam branaddresswhole wheat powderauthentic ingredientsprevious nextpickledescriptionmadewayhealthy alternativenocaloriesetarget prevpanelheadingtime100g 20000 buyhandpicked and groundpungencynatural health mixputtu podicookinglasting freshnessalertenter50gblendjust soelsegravychilli powderfreepodinavara ricevar emailbudsrecipe0dayspicenavara rice powderdish8000 buyvarkashmiricandykitchensvideocontentshoweverychosendryfalse ifisemailemailajaxalertenter valid emailthanbrought backyourtreatedspices100g 5000productsfrytandooritheyifisemailemail alertenterfreshfreshness and flavouralertpleasefisharomaticchembaquantityeasilycuredsubtlemasala powder hasenter phonestatehas beenaddress250g 2500 buyalertenter validfalsepurebeen100g 20000noworiginalpacked using ourdates400ghygienically packed usingselected marinatedprevpanelheadingnumber return falsespices and herbscanthennow kaytraziplastingegg curryroasted ravaiffirstnamefreshnessvalid emailmelamspeciallypincodehave been1right amounttraditional spicessweetifpowder is popularlyyour taste budssoyouragi powderprepareddetailswholesomealsofrizzymelam pack containsfalse returnmasaladescriptionmelamspecialsourcedatalayerpushqualityres2500 buybringing backsundriedflavourchemba puttumasala powder2500 buy nowproperties5herbsour uniqueavacoconutbgingerenjoylastthreehavehometechnologydishesyetbran ricenadupodidescriptionmelamvideoplayercontainerfadeingoodroast masalabeen handpickedemail thisfindemailvaltrim varwhole wheatflavouredeasyback the authenticdatacorianderfirstnamekashmiri chilliidliunique to keralaifisemailemailidgroundbodypanelgrouponhiddenbscollapsebuy now kaytramasala melameggsanjeevanamget500gtasteloverscurrydescriptiontheoffersnow fishfibrepopularly usedputtuaromadosa mixlittlenumber50g 2500carefullywealertplease entertaste of homethen powderedform500gmscartamounttabemailreturn true functionpowderdescriptionsanjeevanamappamidiappamoptionrecipeshotpodi hasreturn trueworryingpodi melamerachicarebestbuywithout worryingfenugreekamountthey are thenbackdish hasmuttonthisfindemailvaltrim varclassicvar firstnamespices and oilampgarlictaste budsravaclassic recipegaram masalapowder this melamperfectpepper500g 80002createmoresuccessrightnotour unique keepwhitewhichwonderfulkeycodeevtcuminthroughhas6000 buy nowmasalagives youcharcodeusesimmunityemail thisfindemailvaltrimbring4chettinad9healthyiffieldfarm freshpowderdescriptionthisevtwhichsanjeevanam bran riceprawn10surekeepfarmbroughtnamemeatgrindinggaramvideoframeattrsrccombinationtraditionalmangoespalm candyfluffy8000 buy nowoutmeendietary fibreswhilepickle madeeasy palappam podialso usedlightseedsbuy now naturalmasala hasourdosahave broughtcoffeepickleflavour theyfalse ifisemailemail alertenterlastnametenderemail return falserevitalisingmeantproportion5000 buy nowtrueerrorrevitalising hairifphonemakereturnalternativeskipping returnidli mixthisfindemailvaltrimpack containsauthentic tastenumber returnbringsbringingpowder sanjeevanamnow traditionalifphone alertpleasedatalayerpush eventground spicesletbuy now traditional100gitspackedactionfieldauthenticrice powderusnatural health8raw100g 5600red ricesugar6000 buysambarfunctiondatamalabar100g 5600 buycreatedconfirmpasswordbran rice powderingredientsusedmelam packappamidiappam podiusing ourmangoroastedfibres and vitaminamlahairskippingoptionselecteddataavailabilityfalse varpickedtheirpowderdescriptionthis melam100g 5000 buyspecial authenticvar phoneback the tastevalueproductobjcategorykashmiri chilli powderchilliesperfect blendview detailsname return falsewhite limefennelhoneygivesidealindianmostnutritiousgoodnesscolour and flavourusing our uniqueetargetretainfavouritechemba puttu podi20000 buydietary fibreselectedidliscoldoriginal flavourfunctionhomemadepackreturn false vartrue functionherbs havetastyname returnayurvedawithoutbring back500g 6000 buyyou makehttpsworldroastfinelybrownbuy now fishpasswordfresh technologyaddviewlifestylevitaminwheatvar email thisfindemailvaltrimvariety3meat masalaphonestockstockquantity0weight500gprice80brandsanjeevanamcategoryricerequiredvitamin bcitykeep fresh technologygive you500g 8000 buyjustmakesrich in dietarytreatpacked usingmasala bringshealth mixmarinated

Longtail Keyword Density for Avacare.in

KeywordsOccurences
melam pack contains18
return false var12
hygienically packed using9
keep fresh technology9
unique keep fresh9
our unique keep9
using our unique9
packed using our9
false return true8
6000 buy now8
powderdescriptionthis melam pack8
powder this melam8
return false return7
return true function7
technology for lasting7
powdered and hygienically6
spices and herbs5
spices and oil5
they are then5
email return false5
2500 buy now5
100g 5000 buy5
5000 buy now5
name return false5
8000 buy now5
7500 buy now5
hand-picked and ground4
masala powder has4
colour and taste4
rich in dietary4
var email thisfindemailvaltrim4
taste of home4
return false ifisemailemail4
alternative to sugar4
buy now kaytra4
your taste buds4
alertenter valid email3
back the taste3
email thisfindemailvaltrim var3
ifisemailemail alertenter valid3
false ifisemailemail alertenter3
ifphone alertplease enter3
freshness and flavour3
colour and flavour3
powder is popularly3
alertplease enter phone3
aroma when you3
valid email return3
natural health mix3
fibres and vitamin3
herbs have been3
kashmiri chilli powder3
100g 5600 buy3
5600 buy now3
meat masala powder3
buy now fish3
chemba puttu podi3
easy palappam podi3
500g 6000 buy3
buy now traditional3
unique to kerala3
have been hand-picked3
brings to you3
100g 7500 buy3
back the authentic3
50g 2500 buy3
sanjeevanam bran rice3
500g 8000 buy3
whole wheat powder3
navara rice powder3
bran rice powder3
buy now natural3
100g 20000 buy3
20000 buy now3
number return false3
buy now80
return false38
alertplease enter22
melam pack18
pack contains18
return true13
false var12
previous next10
has been10
packed using9
unique keep9
using our9
hygienically packed9
keep fresh9
fresh technology9
rice powder9
our unique9
6000 buy8
powderdescriptionthis melam8
navara rice8
false return8
have been7
true function7
bran rice7
lasting freshness6
we have6
bring back6
pickle made6
traditional spices6
powder has6
chilli powder6
masala powder6
puttu podi6
5000 buy5
healthy alternative5
masala melam5
7500 buy5
email return5
dish has5
name return5
you make5
your taste5
100g 50005
2500 buy5
8000 buy5
brought back4
flavour they4
podi has4
meat masala4
authentic combination4
powder sanjeevanam4
taste buds4
right amount4
authentic ingredients4
been hand-picked4
var email4
give you4
you can4
farm fresh4
gives you4
right proportion4
selected marinated4
now kaytra4
podi melam4
email thisfindemailvaltrim4
false ifisemailemail4
var lastname3
var firstname3
skipping return3
datalayerpush event3
etarget prevpanel-heading3
dietary fibres3
vitamin b3
dietary fibre3
authentic taste3
also used3
enter phone3
popularly used3
just so3
ifisemailemail alertenter3
ifphone alertplease3
var phone3
valid email3
specially selected3
thisfindemailvaltrim var3
alertenter valid3
bringing back3
then powdered3
video-content-show video-frameattrsrc3
view details3
palm candy3
appamidiappam podi3
now traditional3
500g 60003
palappam podi3
easy palappam3
idli mix3
let you3
dosa mix3
chemba puttu3
roasted rava3
vegetable masala3
white lime3
garam masala3
roast masala3
egg curry3
perfect blend3
masala has3
tandoori masala3
now fish3
5600 buy3
100g 56003
kashmiri chilli3
mango pickle3
revitalising hair3
health mix3
500g 80003
natural health3
20000 buy3
100g 200003
now natural3
ragi powder3
powder gives3
wheat powder3
whole wheat3
amla powder3
without worrying3
herbs have3
red rice3
sanjeevanam bran3
special authentic3
classic recipe3
50g 25003
original flavour3
have brought3
masala brings3
ground spices3
100g 75003
number return3
now81
buy80
var70
return58
powder44
melam42
false42
you41
taste41
masala39
flavour34
function33
rice32
100g32
sanjeevanam31
your31
spices31
made25
has24
authentic23
alertplease22
enter22
traditional21
true21
natural21
have20
pack20
contains19
fresh18
been17
unique17
back17
kerala16
pickle16
perfect16
our16
aroma15
hair15
herbs15
dish15
healthy14
podi14
colour13
name13
mix13
curry13
all12
honey12
can12
home11
enjoy11
keep11
so11
500g11
ground11
make11
way11
chicken11
email11
every11
50g11
previous10
else10
special10
bring10
rich10
next10
its10
oil10
fish10
right10
using10
blend10
technology9
packed9
mango9
chilli9
we9
selected9
hygienically9
coffee9
kaytra9
puttu9
specially9
which9
roasted8
08
freshness8
400g8
used8
they8
powderdescriptionthis8
ginger8
charcode8
hand-picked8
sambar8
no8
lastthree8
navara8
let8
also8
dishes8
18
day8
dietary8
just8
ayurveda7
combination7
more7
phone7
body7
bran7
then7
mangoes7
27
recipe7
option7
lasting7
if7
ingredients7
sun-dried7
health7
meant7
give7
powdered7
seeds7
vitamin7
helps7
without7
brings6
delicious6
favourite6
alternative6
sugar6
cooked6
palm6
keycode6
spice6
500gms6
event6
products6
world6
pickledescriptionmade6
coriander6
coconut6
sure6
little6
amp6
makes6
url6
afterpoint6
password6
raw6
easy6
time6
red6
cold5
35
masaladescriptionmelam5
proportion5
meal5
wholesome5
documentreadyfunction5
valid5
free5
policy5
iffield5
value5
us5
good5
add5
45
garlic5
tender5
lime5
gives5
idli5
55
dosa5
mutton5
kozhi5
created5
fenugreek5
exotic5
kashmiri5
65
quality5
famous5
farm5
ava5
seasoned5
egg5
brought5
vegetable4
subtle4
nutritious4
retain4
grinding4
prepared4
roast4
lastname4
meen4
tandoori4
breakfast4
source4
thisfindemailvaltrim4
indian4
powderdescriptionsanjeevanam4
c4
alertenter4
out4
other4
flavoured4
recipes4
chettinad4
dry4
variety4
classic4
podidescriptionmelam4
fennel4
hot4
cumin4
amount4
most4
meat4
fry4
pungency4
yet4
chillies4
wheat4
cured4
sweet4
care4
ifisemailemail4
international4
biriyani4
carefully4
candy4
erachi4
address24
city4
state4
zip4
pincode4
marinated4
evtwhich4
shampoo4
treated4
than4
ayurvedic4
frizzy4
whole4
dates4
amla4
success4
palappam4
original4
wonderful4
data4
buds4
functiondata4
productobjcategory4
cartamounttab4
toggleicon4
address3
view3
ava-page-inner-content-outeronsubmit3
ifphone3
bringing3
create3
guntur3
ragi3
offers3
actionfield3
checktimeslotvalfield3
evt3
optionselecteddataavailability3
best3
ecommerce3
through3
details3
list3
kitchens3
firstname3
pure3
stockstockquantity0weight50gprice25brandmelamcategorytamil3
contenturl3
light3
ajax3
datalayerpush3
required3
quantity3
id3
currydescriptionthe3
number3
get3
confirmpassword3
skipping3
iffirstname3
treat3
stockstockquantity0weight100gprice56brandmelamcategoryeveryday3
fluffy3
chemba3
brown3
finely3
error3
https3
panel-grouponshownbscollapse3
panel-grouponhiddenbscollapse3
prevpanel-heading3
etarget3
res3
73
thulasi3
83
rava3
idlis3
malabar3
flavourful3
white3
video-frameattrsrc3
video-content-show3
video-player-containerfadein3
picked3
prawn3
lifestyle3
revitalising3
goodness3
rasam3
fibres3
b3
homemade3
stockstockquantity0weight100gprice200brandsanjeevanamcategorynatural3
cooking3
pepper3
chosen3
popularly3
while3
93
lovers3
103
nadu3
their3
needs3
form3
aromatic3
ideal3
not3
calories3
properties3
uses3
gravy3
tasty3
ingredient3
garam3
appamidiappam3
immunity3
stockstockquantity0weight500gprice80brandsanjeevanamcategoryrice3
easily3
fibre3
worrying3

Who hosts Avacare.in?

Avacare.in Hosting Provider Information

Hosted IP Address:172.104.167.146
Hosted Hostname:srv2.avacare.in
Service Provider:Cipherkey Exchange Corp.
Hosted Country:SingaporeSG
Location Latitude:1.2929
Location Longitude:103.8547
Webserver Software:nginx/1.10.3 (Ubuntu)

Is "Cipherkey Exchange Corp." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Cipherkey Exchange Corp.
0.0196%

HTTP Header Analysis for Avacare.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.10.3 (Ubuntu)
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: no-cache
Date: Sun, 07 Mar 2021 08:41:19 GMT
Content-Encoding: gzip

Avacare.in Domain Nameserver Information

HostIP AddressCountry
ns1.webindia.com 50.16.170.116
ns2.webindia.com 34.235.29.171


Need to find out who hosts Avacare.in?


Domain Registration (WhoIs) information for Avacare.in

 Domain Name: avacare.in
Registry Domain ID: D6588882-IN
Registrar WHOIS Server:
Registrar URL: http://www.net4.in
Updated Date: 2020-09-27T16:12:51Z
Creation Date: 2012-06-28T07:05:24Z
Registry Expiry Date: 2021-06-28T07:05:24Z
Registrar: Net 4 India Limited
Registrar IANA ID: 1007
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: serverDeleteProhibited http://www.icann.org/epp#serverDeleteProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: AVA Cholayil Health Care Pvt ltd
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Tamilnadu
Registrant Postal Code:
Registrant Country: IN
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please contact the Registrar listed above
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please contact the Registrar listed above
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please contact the Registrar listed above
Name Server: ns1.webindia.com
Name Server: ns2.webindia.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-10-15T21:38:41Z

Websites with Similar Names

Avaca.com
Répertoire de l'assurance | Experts | Annuaire Virtuel de l'Assurance Canadien | Canadian Insurance Directory
Avaca.org
Avaca – Artificial Visual Art Composition Assistant
Avacabinetrynea.biz
AVA - Kitchen & Bath Cabinets for life - Home
Avacabinets.ca
Custom kitchen, Bathroom, Importer, Installation, Manufacturer, Quality cabinetry, Wood design, Cabinet maker, Cabinet maker in Ontario, Cabinet make in concord, Kitchen cabinets, Kitchen refacing, Kitchen upgrades, In home kitchen design, Builder Construction, Kitchen cabinets in new market, Kitchen cabinets in richmond hill, Kitchen cabinets in Toronto, Kitchen cabinets in North York, Kitchen cabinets in Vaughan, Kitchen cabinets in Markham, Kitchen cabinets in Scarborough, Kitchen cabinets in Collingwood, Kitchen cabinets in Burlington, Kitchen cabinets in Thornhill, Kitchen cabinets in Etobicoke
Avacad.com
The domain name avacad.com is for sale

Recently Updated Websites

Froggripinc.com (2 seconds ago.)Cloud-s.net (2 seconds ago.)Adn-gruppe.com (3 seconds ago.)Bbuckingham.net (6 seconds ago.)Maximo.top (6 seconds ago.)Aeronpromotionalproducts.com (8 seconds ago.)Intellisult.com (11 seconds ago.)Orhaneli.bel.tr (12 seconds ago.)Threefeatherstreasures.com (14 seconds ago.)Shinkoiwa-seikotsu.com (14 seconds ago.)Cancerguards.com (15 seconds ago.)Gasthaus-linde.ch (17 seconds ago.)Laptops-adapter.co.uk (19 seconds ago.)Bonair.com (19 seconds ago.)Smilecliniq.com (20 seconds ago.)Bursatemizliksirketleri.com (21 seconds ago.)Aoisound.com (22 seconds ago.)Plantationhomefurniture.com (22 seconds ago.)Holbrookfd.org (23 seconds ago.)Soscalemedia.com (24 seconds ago.)Suezremediation.com (24 seconds ago.)Hardonoutdoors.com (24 seconds ago.)Flipmartonlinebazaar.com (28 seconds ago.)Ncitc.com (29 seconds ago.)Qsyhsdk.icu (30 seconds ago.)Ugurbocegiyayinlari.com (32 seconds ago.)73tones.space (32 seconds ago.)Gameinreal.com (33 seconds ago.)Privacyim.info (34 seconds ago.)Truckaccidentca.org (35 seconds ago.)

Recently Searched Keywords

fletes de m (1 second ago.)暗黑大天使 (1 second ago.)paya paya gayan gunawardana (1 second ago.)hrd holiday cards (2 seconds ago.)fletes de mexico a estados unidos (2 seconds ago.)yamaha x ride rp80.000 sewa sekarang (3 seconds ago.)yamaha nmax rp120.000 sewa sekarang (4 seconds ago.)yamaha mio rp70.000 sewa sekarang (5 seconds ago.)fletes de m (5 seconds ago.)yamaha fino rp70.000 sewa sekarang (5 seconds ago.)ms-header-box-icon (6 seconds ago.)fletes de m (6 seconds ago.)best banks (7 seconds ago.)alela (7 seconds ago.)财务信息 (8 seconds ago.)pouch (8 seconds ago.)weddings and events (9 seconds ago.)ruined (9 seconds ago.)tnhits tv shows (10 seconds ago.)status video download (11 seconds ago.)top 03 (13 seconds ago.)蓝光 (14 seconds ago.)06.11.2016 fc perl� - green boys 1:0 (1:0) (15 seconds ago.)neuves (17 seconds ago.)honda civic 2021 pkr 37.3 - 47.0 lacs 256 reviews (17 seconds ago.)accountability and intolerance (17 seconds ago.)哈尔滨工业大学深圳计算机 (18 seconds ago.)airteam near me (18 seconds ago.)обращение с отходами (20 seconds ago.)membershipgrow (20 seconds ago.)