Aviationartgallery.co.uk Favicon Aviationartgallery.co.uk

Aviationartgallery.co.uk Website Thumbnail
Checking...
Aviation Art Gallery Aviation Art - Aircraft Paintings
Low trust score
Add a review Change category Claim this site
Aviation art and limited edition aviation art prints from leading artists including robert taylor,nicolas trudgian,philip west,mark postlethwaite,michael rondot,and many more


Domain summary

Domain label
aviationartgallery
Domain extension
co.uk
Domain registered:
02-Mar-2020
Domain updated:
11-Mar-2020
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is aviationartgallery.co.uk ranked relative to other sites:

Percentage of visits to aviationartgallery.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Aviationartgallery.co.uk registered?
A: Aviationartgallery.co.uk was registered 7 months, 3 weeks, 2 days, 16 hours, 55 minutes, 36 seconds ago on Monday, March 2, 2020.
Q: When was the WHOIS for Aviationartgallery.co.uk last updated?
A: The WHOIS entry was last updated 7 months, 2 weeks, 16 hours, 55 minutes, 36 seconds ago on Wednesday, March 11, 2020.
Q: What are Aviationartgallery.co.uk's nameservers?
A: DNS for Aviationartgallery.co.uk is provided by the following nameservers:
  • ns1.bodhosting.com
  • ns2.bodhosting.com
Q: Who is the registrar for the Aviationartgallery.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Aviationartgallery.co.uk?
A: Aviationartgallery.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Aviationartgallery.co.uk each day?
A: Aviationartgallery.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Aviationartgallery.co.uk resolve to?
A: Aviationartgallery.co.uk resolves to the IPv4 address 174.141.231.74.
Q: In what country are Aviationartgallery.co.uk servers located in?
A: Aviationartgallery.co.uk has servers located in the United States.
Q: What webserver software does Aviationartgallery.co.uk use?
A: Aviationartgallery.co.uk is powered by Apache webserver.
Q: Who hosts Aviationartgallery.co.uk?
A: Aviationartgallery.co.uk is hosted by iWeb Technologies Inc. in New Jersey, Edison, United States, 08837.
Q: How much is Aviationartgallery.co.uk worth?
A: Aviationartgallery.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Aviationartgallery.co.uk?

Aviationartgallery.co.uk Hosting Provider Information

Hosted IP Address:174.141.231.74
Hosted Hostname:bod1.bodhosting.com
Service Provider:iWeb Technologies Inc.
Hosted Country:United StatesUS
Location Latitude:40.4981
Location Longitude:-74.3194
Webserver Software:Apache

Is "iWeb Technologies Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Aviationartgallery.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 20 Oct 2020 21:20:46 GMT
Server: Apache
Last-Modified: Thu, 12 Mar 2020 00:03:28 GMT
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 4958
Content-Type: text/html

Aviationartgallery.co.uk Domain Nameserver Information

HostIP AddressCountry
ns1.bodhosting.com 174.141.231.74
ns2.bodhosting.com 174.141.231.75


Need to find out who hosts Aviationartgallery.co.uk?


WhoIs information for Aviationartgallery.co.uk

 Domain name:
aviationartgallery.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 03-Oct-2019

Registrar:
Safari Ventures Ltd [Tag = SAFVENTURES]

Relevant dates:
Registered on: 02-Mar-2020
Expiry date: 02-Mar-2021
Last updated: 11-Mar-2020

Registration status:
Registered until expiry date.

Name servers:
ns1.bodhosting.com
ns2.bodhosting.com

WHOIS lookup made at 07:21:36 07-May-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Aviationartgallery.co.uk Free SEO Report

Website Inpage Analysis for Aviationartgallery.co.uk

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

36 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

86:
  1. Aviation Art Gallery
    http://aviationartgallery.co.uk/
  2. Aviation Art and Aircraft Paintings
    http://aviationartgallery.co.uk/
  3. No text
    http://aviationartgallery.co.uk/
  4. Aviation Art
    http://aviationartgallery.co.uk/
  5. Aircraft Paintings
    http://aviationartgallery.co.uk/Images/Print-info/Aircraft-paintings.html
  6. Battle of Britain
    http://aviationartgallery.co.uk/Images/Print-info/Battle-of-britain.html
  7. Framed Aviation Art
    http://aviationartgallery.co.uk/Images/Print-info/Framed-aviation-art.html
  8. New Releases
    http://aviationartgallery.co.uk/Images/Print-info/Aviation-art-new-releases.html
  9. Picture Framing
    http://aviationartgallery.co.uk/Images/Print-info/Picture-framing-service.html
  10. Links
    http://aviationartgallery.co.uk/Images/Print-info/Links-info.html
  11. Search
    http://aviationartgallery.co.uk/Images/Print-info/Search-info.html
  12. Ordering
    http://aviationartgallery.co.uk/Images/Print-info/How-to-order.html
  13. About Us
    http://aviationartgallery.co.uk/Images/Print-info/About-us.html
  14. No text
    http://aviationartgallery.co.uk/Images/Print-info/Time-to-go-postlethwaite.html
  15. New Release -Time To Go Mark Postlethwaite
    http://aviationartgallery.co.uk/Images/Print-info/Time-to-go-postlethwaite.html
  16. aviation art
    http://aviationartgallery.co.uk/
  17. aircraft paintings
    http://aviationartgallery.co.uk/
  18. aviation art prints
    http://aviationartgallery.co.uk/
  19. Robert Taylor
    http://aviationartgallery.co.uk/Images/Print-info/Robert-Taylor-aviation-art-one.html
  20. Mark Postlethwaite, Philip West
    http://aviationartgallery.co.uk/Images/Print-info/Mark-Postlethwaite-aviation-art-one.html
  21. Nicolas Trudgian
    http://aviationartgallery.co.uk/Images/Print-info/Nicolas-Trudgian-aviation-art-one.html
  22. Gil Cohen
    http://aviationartgallery.co.uk/Images/Print-info/Gil-Cohen-aviation-art.html
  23. Gerald Coulson
    http://aviationartgallery.co.uk/
  24. Michael Rondot
    http://aviationartgallery.co.uk/Images/Print-info/Michael-Rondot-aviation-art-one.html
  25. Stephen Brown
    http://aviationartgallery.co.uk/Images/Print-info/Stephen-Brown-aviation-art-one.html
  26. Richard Taylor
    http://aviationartgallery.co.uk/Images/Print-info/Richard-Taylor-aviation-art.html
  27. picture framing service
    http://aviationartgallery.co.uk/Images/Print-info/Picture-framing-service.html
  28. aircraft print
    http://aviationartgallery.co.uk/
  29. David Bryant
    http://aviationartgallery.co.uk/Images/Print-info/David-bryant-aviation-art-one.html
  30. Aircraft Paintings
    http://aviationartgallery.co.uk/Images/Print-info/Aircraft-paintings.html
  31. Aviation Art
    http://aviationartgallery.co.uk/
  32. Aircraft Prints
    http://aviationartgallery.co.uk/
  33. Featured Aviation Artists
    http://aviationartgallery.co.uk/
  34. Nicolas Trudgian
    http://aviationartgallery.co.uk/Images/Print-info/Nicolas-Trudgian-aviation-art-one.html
  35. Robert Taylor
    http://aviationartgallery.co.uk/Images/Print-info/Robert-Taylor-aviation-art-one.html
  36. David Bryant
    http://aviationartgallery.co.uk/Images/Print-info/David-bryant-aviation-art-one.html
  37. Philip West
    http://aviationartgallery.co.uk/Images/Print-info/Philip-West-aviation-art-one.html
  38. Richard Taylor
    http://aviationartgallery.co.uk/Images/Print-info/Richard-Taylor-aviation-art.html
  39. Mark Postlethwaite
    http://aviationartgallery.co.uk/Images/Print-info/Mark-Postlethwaite-aviation-art-one.html
  40. Michael Rondot
    http://aviationartgallery.co.uk/Images/Print-info/Michael-Rondot-aviation-art-one.html
  41. Gil Cohen
    http://aviationartgallery.co.uk/Images/Print-info/Gil-Cohen-aviation-art.html
  42. Stephen Brown
    http://aviationartgallery.co.uk/Images/Print-info/Stephen-Brown-aviation-art-one.html
  43. Gerald Coulson
    http://aviationartgallery.co.uk/
  44. Anthony Saunders
    http://aviationartgallery.co.uk/Images/Print-info/Anthony-Saunders-aviation-art.html
  45. Aviation Art Books
    http://aviationartgallery.co.uk/Images/Print-info/Aviation-art-books.html
  46. No text
    http://aviationartgallery.co.uk/Images/Print-info/Aviation-art-books.html
  47. Nicolas Trudgian Aviation Sketchbook
    http://aviationartgallery.co.uk/Images/Print-info/Aviation-art-books.html
  48. Gil Cohen Aviation Artist
    http://aviationartgallery.co.uk/Images/Print-info/Aviation-art-books.html
  49. Robert Taylor Combat Paintings Volume VI
    http://aviationartgallery.co.uk/Images/Print-info/Aviation-art-books.html
  50. Battle Of Britain Robert Taylor
    http://aviationartgallery.co.uk/Images/Print-info/Aviation-art-books.html
  51. New Releases Added 9/12/2017 Click Here For Details
    http://aviationartgallery.co.uk/Images/Print-info/Aviation-art-new-releases.html
  52. No text
    http://aviationartgallery.co.uk/Images/Print-info/Winter-halifax.html
  53. No text
    http://aviationartgallery.co.uk/Images/Print-info/The-black-horse-over-banburgh.html
  54. No text
    http://aviationartgallery.co.uk/Images/Print-info/Mosquitos-at-dusk.html
  55. Winter Halifax Mark Postlethwaite
    http://aviationartgallery.co.uk/Images/Print-info/Winter-halifax.html
  56. The Black Horse Over Bamburgh Mark Postlethwaite
    http://aviationartgallery.co.uk/Images/Print-info/The-black-horse-over-banburgh.html
  57. Mosquitos At Dusk Gerald Coulson
    http://aviationartgallery.co.uk/Images/Print-info/Mosquitos-at-dusk.html
  58. Aviation Art New Releases
    http://aviationartgallery.co.uk/Images/Print-info/Aviation-art-new-releases.html
  59. No text
    http://aviationartgallery.co.uk/Images/Print-info/Buccaneer-blue-fire.html
  60. No text
    http://aviationartgallery.co.uk/Images/Print-info/Headlong-into-the-clash.html
  61. No text
    http://aviationartgallery.co.uk/Images/Print-info/Lightning-thunder.html
  62. Buccaneer Blue Fire Michael Rondot
    http://aviationartgallery.co.uk/Images/Print-info/Buccaneer-blue-fire.html
  63. Headlong Into The Clash Robert Taylor
    http://aviationartgallery.co.uk/Images/Print-info/Headlong-into-the-clash.html
  64. Lightning Thunder Michael Rondot
    http://aviationartgallery.co.uk/Images/Print-info/Lightning-thunder.html
  65. Featured Aviation Artists
    http://aviationartgallery.co.uk/
  66. No text
    http://aviationartgallery.co.uk/Images/Print-info/David-bryant-aviation-art-one.html
  67. No text
    http://aviationartgallery.co.uk/Images/Print-info/Nicolas-Trudgian-aviation-art-one.html
  68. No text
    http://aviationartgallery.co.uk/Images/Print-info/Richard-Taylor-aviation-art.html
  69. No text
    http://aviationartgallery.co.uk/Images/Print-info/Gil-Cohen-aviation-art.html
  70. David Bryant Aviation Art
    http://aviationartgallery.co.uk/Images/Print-info/David-bryant-aviation-art-one.html
  71. Nicolas Trudgian Aviation Art
    http://aviationartgallery.co.uk/Images/Print-info/Nicolas-Trudgian-aviation-art-one.html
  72. Gerald Coulson Aviation Art
    http://aviationartgallery.co.uk/
  73. Richard Taylor Aviation Art
    http://aviationartgallery.co.uk/Images/Print-info/Richard-Taylor-aviation-art.html
  74. Gil Cohen Aviation Art
    http://aviationartgallery.co.uk/Images/Print-info/Gil-Cohen-aviation-art.html
  75. No text
    http://aviationartgallery.co.uk/Images/Print-info/Stephen-Brown-aviation-art-one.html
  76. No text
    http://aviationartgallery.co.uk/Images/Print-info/Philip-West-aviation-art-one.html
  77. No text
    http://aviationartgallery.co.uk/Images/Print-info/Robert-Taylor-aviation-art-one.html
  78. No text
    http://aviationartgallery.co.uk/Images/Print-info/Mark-Postlethwaite-aviation-art-one.html
  79. No text
    http://aviationartgallery.co.uk/Images/Print-info/Michael-Rondot-aviation-art-one.html
  80. Stephen Brown Aviation Art
    http://aviationartgallery.co.uk/Images/Print-info/Stephen-Brown-aviation-art-one.html
  81. Philip West Aviation Art
    http://aviationartgallery.co.uk/Images/Print-info/Philip-West-aviation-art-one.html
  82. Robert Taylor Aviation Art
    http://aviationartgallery.co.uk/Images/Print-info/Robert-Taylor-aviation-art-one.html
  83. Mark Postlethwaite Aviation Art
    http://aviationartgallery.co.uk/Images/Print-info/Mark-Postlethwaite-aviation-art-one.html
  84. Michael Rondot Aviation Art
    http://aviationartgallery.co.uk/Images/Print-info/Michael-Rondot-aviation-art-one.html
  85. Sitemap
    http://aviationartgallery.co.uk/Images/Print-info/Site-Map.html
  86. © Aviation Art Gallery
    http://aviationartgallery.co.uk/Images/Print-info/Framing-samples.html

Links - Internal (nofollow)

0:

Links - Outbound

5:
  1. No text
    http://www.helpforheroes.org.uk/
  2. Please Help Support Our Wounded
    http://www.helpforheroes.org.uk/
  3. No text
    http://www.vulcantothesky.org/
  4. Avro Vulcan XH558 Urgent Appeal
    http://www.vulcantothesky.org/
  5. No text
    http://www.facebook.com/pages/Aviation-Art-Gallery/221976904571706

Links - Outbound (nofollow)

0:

Keyword Cloud for Aviationartgallery.co.uk

geraldreleasestaylorrobert taylordavidmarkaviation art gallerystephenphilipnewrichardmark postlethwaiteart printswegalleryaviationmichaelgiluscoulsonlimitedbryantpaintingssignedart galleryrichard taylorphilip westyoulimited edition aviationaviation art printscohenlimited editionedition aviation artnbsp nbspnew releasesaviation artaviation artistsmichael rondotwebsitenbsppostlethwaitegerald coulsonartmanywestfeaturedaircraftrobertourprintseditionedition aviationnbsp nbsp nbsptrudgianstephen browngil cohennicolas trudgianbrownnicolasaircraft paintingsrondotartistsdavid bryant

Longtail Keyword Density for Aviationartgallery.co.uk

KeywordsOccurences
nbsp nbsp nbsp11
aviation art gallery6
limited edition aviation3
edition aviation art3
aviation art prints3
aviation art29
nbsp nbsp16
mark postlethwaite7
robert taylor6
art gallery6
michael rondot6
nicolas trudgian6
gerald coulson5
gil cohen5
aircraft paintings5
limited edition4
stephen brown4
new releases3
aviation artists3
art prints3
edition aviation3
richard taylor3
david bryant3
philip west3
aviation37
art30
nbsp22
taylor9
our7
gallery7
aircraft7
mark7
postlethwaite7
robert6
michael6
rondot6
new6
nicolas6
paintings6
trudgian6
coulson5
gerald5
cohen5
many5
gil5
stephen4
brown4
featured4
artists4
prints4
edition4
limited4
website4
you4
west3
philip3
we3
us3
richard3
david3
bryant3
releases3
signed3

Aviationartgallery.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Aviationartgallery.co.uk is a scam?

Websites with Similar Names

Aviata.kz
Авиабилеты - купить дешевые авиабилеты в Казахстане онлайн на aviata.kz
Aviata.me
Авиабилеты - купить дешевые авиабилеты в Казахстане онлайн на aviata.kz
Aviatablo.ru
????????? ?????? ????? ??????????: ?????????? ?????? ?????????, ?????????? ??????????, ?????????? ??????????. ?????????? ??????? ????-?????? ? ????????? ?? ??????. ?????????? ???????? ??????, ??????, ??????? (????????) ?????????.
Aviatagk.com
开心娱乐_首页
Aviataircraft.com
Aircraft Manufacturer | Pitts, Husky, Eagle Aircraft - Aviat
Aviataircraftsales.com
Aircraft Manufacturer | Pitts, Husky, Eagle Aircraft - Aviat
Aviatas.com
Not Found
Aviatasports.com
Aviata Sports - America's #1 Goalkeeper Specialist Brand - Inspiring and Innovating Keeper Culture
Aviatastrain.com
TAG Aviation Spain | Delivering Training Where You Want It!

Recently Updated Websites

Megara-f.com 1 second ago.Millegradi.net 3 seconds ago.Graduatingtheuniversityoflife.com 3 seconds ago.Prank-phone-calls.com 4 seconds ago.Tuneband.pl 4 seconds ago.Lucazoid.com 4 seconds ago.Funnelback.com 4 seconds ago.Amorinoarabia.com 5 seconds ago.660865.xyz 5 seconds ago.Wellnesscortex.com 5 seconds ago.Thomas-riemann.com 5 seconds ago.Rafterdettails-awp.com 5 seconds ago.Mauimiller.com 5 seconds ago.Calzado-caribu.com.mx 5 seconds ago.Woodrufflawfirm.com 6 seconds ago.Joinbalistreri.com 6 seconds ago.Thebrewdoctorinc.com 6 seconds ago.Ringlokschuppen.com 6 seconds ago.Greenbrier-emergency.com 8 seconds ago.Boxingshop.net 8 seconds ago.Cherijmeiners.net 8 seconds ago.Disabilityarizona.com 9 seconds ago.Grm-consulting.com 9 seconds ago.Polishmeprettynailandlashbar.com 10 seconds ago.Stuntsa.com 10 seconds ago.Tldynasty.com 10 seconds ago.Mearapartments.gr 10 seconds ago.Johnryoung.org 11 seconds ago.Themercantileevent.com 11 seconds ago.Lomirasportsmensclub.com 11 seconds ago.