Avillageimoveis.com.br Favicon Avillageimoveis.com.br

Avillageimoveis.com.br Website Thumbnail
Checking...
Imobiliária Avillage Imóveis
Low trust score
Add a review Change category Claim this site
Imob A Village Imóveis S S Ltda Me imovéis para venda e locação


Domain summary

Domain label
avillageimoveis
Domain extension
com.br
Domain registered:
2009-10-27
Domain updated:
2018-11-14
Domain expires:
2020-10-27
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is avillageimoveis.com.br ranked relative to other sites:

Percentage of visits to avillageimoveis.com.br from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Avillageimoveis.com.br registered?
A: Avillageimoveis.com.br was registered 11 years, 5 days, 1 hour, 3 minutes, 43 seconds ago on Tuesday, October 27, 2009.
Q: When was the WHOIS for Avillageimoveis.com.br last updated?
A: The WHOIS entry was last updated 1 year, 11 months, 2 weeks, 3 days, 1 hour, 3 minutes, 43 seconds ago on Wednesday, November 14, 2018.
Q: What are Avillageimoveis.com.br's nameservers?
A: DNS for Avillageimoveis.com.br is provided by the following nameservers:
  • ns1.gaiasite.com.br
  • ns2.gaiasite.com.br
  • ns3.gaiasite.com.br
  • ns4.gaiasite.com.br
Q: Who is the registrar for the Avillageimoveis.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Avillageimoveis.com.br?
A: Avillageimoveis.com.br has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Avillageimoveis.com.br each day?
A: Avillageimoveis.com.br receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Avillageimoveis.com.br resolve to?
A: Avillageimoveis.com.br resolves to the IPv4 address 151.139.128.10.
Q: In what country are Avillageimoveis.com.br servers located in?
A: Avillageimoveis.com.br has servers located in the United States.
Q: What webserver software does Avillageimoveis.com.br use?
A: Avillageimoveis.com.br is powered by webserver.
Q: Who hosts Avillageimoveis.com.br?
A: Avillageimoveis.com.br is hosted by Thorn Communications, Inc in Texas, Dallas, United States, 75201.
Q: How much is Avillageimoveis.com.br worth?
A: Avillageimoveis.com.br has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Avillageimoveis.com.br?

Avillageimoveis.com.br Hosting Provider Information

Hosted IP Address:151.139.128.10
Hosted Hostname:151.139.128.10
Service Provider:Thorn Communications, Inc
Hosted Country:United StatesUS
Location Latitude:32.7889
Location Longitude:-96.8021
Webserver Software:Not Applicable

Is "Thorn Communications, Inc" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Avillageimoveis.com.br

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sun, 11 Oct 2020 15:38:27 GMT
Accept-Ranges: bytes
Cache-Control: max-age=0
Location: https://avillageimoveis.com.br/
X-HW: 1602430707.cds034.lo4.h2,1602430707.cds254.lo4.c
Access-Control-Allow-Origin: *
Connection: keep-alive
Content-Length: 0

Avillageimoveis.com.br Domain Nameserver Information

HostIP AddressCountry
ns1.gaiasite.com.br 52.67.32.44
ns2.gaiasite.com.br 52.67.32.44
ns3.gaiasite.com.br 52.67.46.11
ns4.gaiasite.com.br 54.232.103.79


Need to find out who hosts Avillageimoveis.com.br?


Domain Registration (WhoIs) information for Avillageimoveis.com.br

 % Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2020-10-11T12:38:29-03:00 - IP: 165.232.46.170

domain: avillageimoveis.com.br
owner: OSIAS DE SOUZA GINEL
owner-c: OSSGI2
tech-c: MAP1046
nserver: ns1.gaiasite.com.br
nsstat: 20201008 AA
nslastaa: 20201008
nserver: ns2.gaiasite.com.br
nsstat: 20201008 AA
nslastaa: 20201008
nserver: ns3.gaiasite.com.br
nsstat: 20201008 AA
nslastaa: 20201008
nserver: ns4.gaiasite.com.br
nsstat: 20201008 AA
nslastaa: 20201008
created: 20091027 #6204459
changed: 20181114
expires: 20201027
status: published

nic-hdl-br: OSSGI2
person: OSIAS DE SOUZA GINEL
created: 20091026
changed: 20180926

nic-hdl-br: MAP1046
person: Matheus Alexandre Poletto
created: 20020824
changed: 20200407

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, CIDR block, IP and ASN.

Avillageimoveis.com.br Free SEO Report

Website Inpage Analysis for Avillageimoveis.com.br

H1 Headings

1 :
  1. Imobiliária Avillage Imóveis - Imob A Village Imóveis S S Ltda Me

H2 Headings

11 :
  1. Menu
  2. Imóveis
  3. Serviços
  4. Contato
  5. Oportunidades de Negócio
  6. Lançamentos em destaque
  7. Mais destaques
  8. Imóvel sob encomenda
  9. Financiamento
  10. Cadastre seu imóvel
  11. Pesquisas mais populares

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

28:
  1. Avillageimoveis Encomende seu imóvel
    http://www.avillageimoveis.com.br/encomende-seu-imovel
  2. Avillageimoveis Cadastre seu imóvel
    http://www.avillageimoveis.com.br/cadastre-seu-imovel
  3. Avillageimoveis Condomínios
    http://www.avillageimoveis.com.br/condominios
  4. Avillageimoveis Financiamento e bancos
    http://www.avillageimoveis.com.br/financiamento-e-bancos
  5. Avillageimoveis Fale conosco
    http://www.avillageimoveis.com.br/fale-conosco
  6. Avillageimoveis Cadastre seu imóvel Preencha o formulário
    http://avillageimoveis.com.br/cadastre-seu-imovel
  7. Avillageimoveis Imobiliária Avillage Imóveis - Imob A Village Imóveis S S Ltda Me
    http://www.avillageimoveis.com.br
  8. http://avillageimoveis.com.br/
    http://avillageimoveis.com.br/
  9. Avillageimoveis Encomende seu imóvel
    http://avillageimoveis.com.br/imovel-sob-encomenda
  10. Avillageimoveis Faça uma simulação
    http://avillageimoveis.com.br/financiamento
  11. Avillageimoveis Cadastre seu imóvel
    http://avillageimoveis.com.br/cadastro-imovel
  12. Avillageimoveis Casas à venda Jardim Novo Bongiovani
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/jardim-novo-bongiovani
  13. Avillageimoveis Casas à venda Porto Seguro Residence
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/porto-seguro-residence
  14. Avillageimoveis Casas à venda Parque Residencial Damha II
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/parque-residencial-damha-ii
  15. Avillageimoveis Terrenos à venda Porto Madero Residence
    http://avillageimoveis.com.br/imoveis/a-venda/terreno/presidente-prudente/porto-madero-residence
  16. Avillageimoveis Apartamentos para alugar Vila Liberdade
    http://avillageimoveis.com.br/imoveis/para-alugar/apartamento/presidente-prudente/vila-liberdade
  17. Avillageimoveis Terrenos à venda Parque Residencial Damha III
    http://avillageimoveis.com.br/imoveis/a-venda/terreno/presidente-prudente/parque-residencial-damha-iii
  18. Avillageimoveis Casas à venda Jardim Maracanã
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/jardim-maracana
  19. Avillageimoveis Casas à venda Parque Residencial Damha III
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/parque-residencial-damha-iii
  20. Avillageimoveis Casas à venda Parque Residencial Damha
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/parque-residencial-damha
  21. Avillageimoveis Apartamentos para alugar Jardim Eldorado
    http://avillageimoveis.com.br/imoveis/para-alugar/apartamento/presidente-prudente/jardim-eldorado
  22. Avillageimoveis Casas à venda Conjunto Habitacional Ana Jacinta
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/conjunto-habitacional-ana-jacinta
  23. Avillageimoveis Casas à venda Parque Residencial Servantes II
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/parque-residencial-servantes-ii
  24. Avillageimoveis Casas à venda Porto Madero Residence
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/porto-madero-residence
  25. Avillageimoveis Casas à venda Residencial Bongiovani Presidente
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/residencial-bongiovani-presidente
  26. Avillageimoveis Casas à venda Vila Formosa
    http://avillageimoveis.com.br/imoveis/a-venda/casa/presidente-prudente/vila-formosa
  27. http://www.avillageimoveis.com.br
    http://www.avillageimoveis.com.br
  28. Avillageimoveis Como chegar
    http://avillageimoveis.com.br/fale-conosco#maps

Links - Internal (nofollow)

0:

Links - Outbound

4:
  1. Avillageimoveis Tire suas dúvidas
    https://api.whatsapp.com/send?phone=5518991559417
  2. Avillageimoveis  (18) 99155-9417 
    https://api.whatsapp.com/send?phone=5518991559417
  3. Avillageimoveis   (18) 99155-9417  
    https://api.whatsapp.com/send?phone=5518991559417
  4. http://www.ingaia.com.br/
    http://www.ingaia.com.br/

Links - Outbound (nofollow)

0:

Keyword Cloud for Avillageimoveis.com.br

u003cdiv018991559417terrenos vendavoc procurafalaptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfapara venda ecasasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenu superior localizadomelhorfield039087172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber18 39087273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber18 991559417suffixcarriertimwhatsapptrueshowtruemainfalsedisplayaddressvilacasasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenu superiorimveis svenda parqueformosastatespcitypresidente prudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontatopginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfa falaptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfalike gecko chrome61031430aluguelapplewebkit53736 khtml likedvidasu003cdivu003cau003cdivcodejavascriptnullcondopagetruedefaultscopenullfaviconurlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxs7danjuev7tewtj5tet1ozqgzm1jnjavufrcjadqk2nyq4sn9uzultlp41e0ii0wvb63pyib08lptod9go937x4npydrbfez57sdugfwutqsiuqdrstury0xzboajhewyvi7cnyybzxwgdpajrhdjanmkxoyd4dngohflyi3nednso9blmc4dfghvfajpgfaviconuselogotipotruegooglemapspublickeyaizasydq9qbnewxtbxqtm91rbljwrbvrmsxee4googletagmanagernullgoogletranslatefalsegoogleuanullimgapiurlhttpsimgskenloioingaiaadsfalseingaiaadscalltrackingnullingaiaadsparamsnullingaiaadsuidnullingaiacampusurlnullingaiacapitalgenericfalseingaiacapitallistingfalseaccountnulldigitalrentalfalseleadsapiurlhttpleadsingaiacombrleadsingaialistingsownonlyfalselockedversion2logotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbbgosbt9ro1zjksyncilnlxpdkzsucvzkpvmzhgtgi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip9hwyvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgmetadescriptionimobu003cstyleparqueapartamentos casasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenu superioro melhorqueda pginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfa falaptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfau003ctd u003ctrmefaphonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliria avillage imveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96logo2020a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9logo2020a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber18ofertas de crditoaluguel 018991559417 eno topo991559417suffixcarriertimwhatsapptrueshowtruemainfalsedisplayaddressvilaofertastopovenda jardimu003ctableterrenosendforfabookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfa faphonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliria avillageda pginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenuporto maderocrditoformosaneighborhoodshortvl formosastatespcitypresidenteimobiliria venda locaocrdito para voccorretores imobiliria vendau003ctrdamelhoresme imoveis corretoresamboslocaoparque residencial damhaapartamentos casasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenumaiozip19050050neighborhoodvilaportowindowspginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenu inferior localizadolikeimveisvenda evocpginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenunegciofeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeimoveistabsfalselayout12placeholderlanamentosu003ctr u003ctbody u003ctablefinanciar seusuperior localizadoem destaquefeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeempreendimentostabsfalselayout10placeholdermaisltdawindowmarkosections windowmarkosectionsvenda locao apartamentosencontraremosimvelmelhores ofertasifimovis para venda39087172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber18village imveis svenda locaowhatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjksyncilnlxpdkzsucvzkpvmzhgtgi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip9hwyvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhflhpy3rwpsl805m2zrl4rj4mnbeu7attkgwojtvibb9h7rxl7zlvx8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8czyk8viqhhdnx2r2arwwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177cgpsfalsecurrentlanguageptbreditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeenustitleenglishcodeptbrtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdataapiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla50onzecontatoimobiliriaprudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontatoabaixopara voccasasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenuapplewebkit53736o melhor negcioconosco nsome imoveispara voc financiare contato parafaphonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliria avillageno rodapmaislike geckoaluguel 018991559417sobfalaptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfa fahomepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfavendalocalizadolocaometakeywordsimob a villagefahomepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfa fabookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfa faphonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliriadvidasu003cdivu003cau003cdivcodejavascriptnullcondopagetruedefaultscopenullfaviconurlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxs7danjuev7tewtj5tet1ozqgzm1jnjavufrcjadqk2nyq4sn9uzultlp41e0ii0wvb63pyib08lptod9go937x4npydrbfez57sdugfwutqsiuqdrstury0xzboajhewyvi7cnyybzxwgdpajrhdjanmkxoyd4dngohflyi3nednso9blmc4dfghvfajpgfaviconuselogotipotruegooglemapspublickeyaizasydq9qbnewxtbxqtm91rbljwrbvrmsxee4googletagmanagernullgoogletranslatefalsegoogleuanullimgapiurlhttpsimgskenloioingaiaadsfalseingaiaadscalltrackingnullingaiaadsparamsnullingaiaadsuidnullingaiacampusurlnullingaiacapitalgenericfalseingaiacapitallistingfalseaccountnulldigitalrentalfalseleadsapiurlhttpleadsingaiacombrleadsingaialistingsownonlyfalselockedversion2logotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbbgosbt9ro1zjksyncilnlxpdkzsucvzkpvmzhgtgi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip9hwyvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgmetadescriptionimob a villageavisaremos quando991559417suffixcarriertimwhatsapptrueshowtruemainfalsedisplayaddressvila formosalat2213438606262207lng51397117614746094number931additionaladdressurladdresses824517typeavenidanameonzeu003ctbody u003ctablevenda 018996607172 ambos39087172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber18 39087273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber1839087273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber18 991559417suffixcarriertimwhatsapptrueshowtruemainfalsedisplayaddressvila formosalat2213438606262207lng51397117614746094number931additionaladdressurladdresses824517typeavenidanameonzemelhor negcioinferior localizado nou003cspan u003cpmaiozip19050050neighborhoodvila formosaneighborhoodshortvle ns avisaremosrodap davenda parque residencialpresidentecasascontato para imveiss ltda melocalizado no rodaptopo daimvel quevillagenegcio parae ns018996607172 ambos whatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjksyncilnlxpdkzsucvzkpvmzhgtgi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip9hwyvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhflhpy3rwpsl805m2zrl4rj4mnbeu7attkgwojtvibb9h7rxl7zlvx8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8czyk8viqhhdnx2r2arwwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177cgpsfalsecurrentlanguageptbreditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeenustitleenglishcodeptbrtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdataapiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla50falaptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfa fahomepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfa fabookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfada pginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenu inferiornoimveis de venda01899660717239087273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber18 991559417suffixcarriertimwhatsapptrueshowtruemainfalsedisplayaddressvilawidthme imovisvenda e locaometakeywordsimobcasas vendaimveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96logo2020a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9logo2020a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber18 39087172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber18 39087273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber18snegcioavisaremosalugaravillage imveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96logo2020a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9logo2020a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber18residencialimovis paragecko chrome61031430localizado nomelhor negcio parainferior localizadont 63fabookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfa faphonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliriavenda portoformosastatespcitypresidente prudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontato parasuperior localizado nodamhawindowmarkovarswow64 applewebkit53736 khtmlprocura e nsu003ctable u003cdivavillage imveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96logo2020a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9logo2020a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber18 39087172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber18eformosastatespcitypresidentens avisaremosfinanciarprudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontato para imveisnegciofeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeimoveistabsfalselayout12placeholderlanamentos em destaquefeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeempreendimentostabsfalselayout10placeholdermais39087273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber18e locaometakeywordsimobprudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontato paralocao apartamentosmaiozip19050050neighborhoodvila formosaneighborhoodshortvl formosastatespcitypresidentevoc financiaru003cspanu003ctbodyns encontraremosformosaneighborhoodshortvllocalizado no toporodap da pginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfau003ctr u003ctbodymaderofieldapplewebkit53736 khtmljardimemelsekhtmlparque residencial1locaometakeywordsimobimveis s sambos whatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjksyncilnlxpdkzsucvzkpvmzhgtgi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip9hwyvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhflhpy3rwpsl805m2zrl4rj4mnbeu7attkgwojtvibb9h7rxl7zlvx8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8czyk8viqhhdnx2r2arwwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177cgpsfalsecurrentlanguageptbreditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeenustitleenglishcodeptbrtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdataapiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla50suase contatoendifimoveis corretoresformosalat2213438606262207lng51397117614746094number931additionaladdressurladdresses824517typeavenidanameonze de maiozip19050050neighborhoodvilamaiowow64 applewebkit53736pluralpara imveisu003ctd u003ctr u003ctbodyns avisaremos quandou003cspan u003cspan u003cps simveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96logo2020a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9logo2020a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber18rodapcrdito paracasas venda jardimimveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96logo2020a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9logo2020a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber18 39087172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber18quandokhtml like geckoo imvel quefahomepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfaimvel que voc018991559417 eu003ctbody u003ctable u003cdivcasas venda parqueda pginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfaformosaneighborhoodshortvl formosastatespcitypresidente prudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontatolocao apartamentos casasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenupginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenu inferiorcorretores imobiliriao imvelimoveiswindowmarkovars windowmarkovarsltda me imoveisprocurawindowmarkosectionsresidencial damhano topo davilapara alugarme imovis paraonze de maiovenda porto maderocorretoresns encontraremos oencontraremos o melhorambos whatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjksyncilnlxpdkzsucvzkpvmzhgtgi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip9hwyvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhflhpy3rwpsl805m2zrl4rj4mnbeu7attkgwojtvibb9h7rxl7zlvx8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8czyk8viqhhdnx2r2arwwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177cgpsfalsecurrentlanguageptbreditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeenustitleenglishcodeptbrtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdataapiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla50 windowswindows nt 63imveis de aluguelinferiorconoscoapartamentos paracontato paras ltdaque vocwindows nt63 wow64u003cspan u003cspanapartamentos018996607172 ambosu003cdiv u003ctd u003ctrfabookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfaque voc procuraltda me imovisimoveis corretores imobiliriasuperiordestaquefeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeempreendimentostabsfalselayout10placeholdermaisfunctionntgeckou003cdiv u003ctdencontraremos oconosco ns encontraremosapartamentos para alugarltda meno rodap dabongiovanipara vendavillage imveisseu63 wow64 applewebkit53736voc financiar seuwhatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjksyncilnlxpdkzsucvzkpvmzhgtgi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip9hwyvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhflhpy3rwpsl805m2zrl4rj4mnbeu7attkgwojtvibb9h7rxl7zlvx8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8czyk8viqhhdnx2r2arwwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177cgpsfalsecurrentlanguageptbreditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeenustitleenglishcodeptbrtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdataapiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla50 windowsu003cpchrome61031430procura eresidenceu003cau003cliu003cipginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfau003ctable u003cdiv u003ctdimovisnegciofeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeimoveistabsfalselayout12placeholderlanamentos em018991559417 e contatowow64khtml likes s ltdavoc procura esuas dvidasu003cdivu003cau003cdivcodejavascriptnullcondopagetruedefaultscopenullfaviconurlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxs7danjuev7tewtj5tet1ozqgzm1jnjavufrcjadqk2nyq4sn9uzultlp41e0ii0wvb63pyib08lptod9go937x4npydrbfez57sdugfwutqsiuqdrstury0xzboajhewyvi7cnyybzxwgdpajrhdjanmkxoyd4dngohflyi3nednso9blmc4dfghvfajpgfaviconuselogotipotruegooglemapspublickeyaizasydq9qbnewxtbxqtm91rbljwrbvrmsxee4googletagmanagernullgoogletranslatefalsegoogleuanullimgapiurlhttpsimgskenloioingaiaadsfalseingaiaadscalltrackingnullingaiaadsparamsnullingaiaadsuidnullingaiacampusurlnullingaiacapitalgenericfalseingaiacapitallistingfalseaccountnulldigitalrentalfalseleadsapiurlhttpleadsingaiacombrleadsingaialistingsownonlyfalselockedversion2logotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbbgosbt9ro1zjksyncilnlxpdkzsucvzkpvmzhgtgi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip9hwyvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgmetadescriptionimob0nsfaphonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliriaavillagent 63 wow642formosalat2213438606262207lng51397117614746094number931additionaladdressurladdresses824517typeavenidanameonzecasas venda portoimobiliria vendavenda 018996607172residencewhatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjksyncilnlxpdkzsucvzkpvmzhgtgi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip9hwyvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhflhpy3rwpsl805m2zrl4rj4mnbeu7attkgwojtvibb9h7rxl7zlvx8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8czyk8viqhhdnx2r2arwwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177cgpsfalsecurrentlanguageptbreditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeenustitleenglishcodeptbrtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdataapiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla50 windows nttopo da pginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenupginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfa falaptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfa fahomepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfau003ctdparaumafahomepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfa fabookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfa

Longtail Keyword Density for Avillageimoveis.com.br

KeywordsOccurences
village imveis s22
s s ltda22
imveis s s22
s ltda me18
ltda me imovis12
me imovis para12
imovis para venda12
para venda e12
u003ctd u003ctr u003ctbody10
venda parque residencial10
u003ctr u003ctbody u003ctable10
u003cdiv u003ctd u003ctr9
casas venda parque8
imveis de aluguel7
parque residencial damha7
u003ctbody u003ctable u003cdiv7
venda 01899660-7172 ambos7
imveis de venda7
contato para imveis7
e contato para7
aluguel 01899155-9417 e7
01899155-9417 e contato7
wow64 applewebkit53736 khtml6
imobiliria venda locao6
venda locao apartamentos6
windows nt 636
nt 63 wow646
63 wow64 applewebkit537366
applewebkit53736 khtml like6
like gecko chrome610314306
khtml like gecko6
corretores imobiliria venda6
imoveis corretores imobiliria6
me imoveis corretores6
ltda me imoveis6
u003ctable u003cdiv u003ctd6
casasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenu superior localizado5
da pginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenu inferior5
locaometakeywordsimob a village5
whatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjks-yncilnlxpdkzsucvzkpvmzhgt-gi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip-9hw-yvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhfl-hpy3r-wpsl805m2zrl4rj4mnbeu7a-ttkgwojtvibb9h7rxl7zlvx-8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8cz-yk8viqhhdnx2r2ar-wwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177-cgpsfalsecurrentlanguagept-breditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeen-ustitleenglishcodept-brtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdata-apiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla50 windows nt5
ambos whatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjks-yncilnlxpdkzsucvzkpvmzhgt-gi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip-9hw-yvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhfl-hpy3r-wpsl805m2zrl4rj4mnbeu7a-ttkgwojtvibb9h7rxl7zlvx-8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8cz-yk8viqhhdnx2r2ar-wwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177-cgpsfalsecurrentlanguagept-breditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeen-ustitleenglishcodept-brtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdata-apiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla50 windows5
01899660-7172 ambos whatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjks-yncilnlxpdkzsucvzkpvmzhgt-gi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip-9hw-yvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhfl-hpy3r-wpsl805m2zrl4rj4mnbeu7a-ttkgwojtvibb9h7rxl7zlvx-8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8cz-yk8viqhhdnx2r2ar-wwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177-cgpsfalsecurrentlanguagept-breditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeen-ustitleenglishcodept-brtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdata-apiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla505
venda e locaometakeywordsimob5
locao apartamentos casasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenu5
apartamentos casasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenu superior5
topo da pginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenu5
superior localizado no5
fa-bookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfa fa-phonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliria avillage5
fa-laptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfa fa-homepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfa fa-bookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfa5
pginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfa fa-laptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfa fa-homepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfa5
da pginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfa fa-laptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfa5
localizado no topo5
rodap da pginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfa5
no rodap da5
localizado no rodap5
inferior localizado no5
fa-homepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfa fa-bookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfa fa-phonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliria5
pginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenu inferior localizado5
fa-phonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliria avillage imveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96-logo20-20a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9-logo20-20a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber185
imveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96-logo20-20a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9-logo20-20a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber18 3908-7172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber18 3908-7273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber185
3908-7172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber18 3908-7273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber18 99155-9417suffixcarriertimwhatsapptrueshowtruemainfalsedisplayaddressvila5
3908-7273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber18 99155-9417suffixcarriertimwhatsapptrueshowtruemainfalsedisplayaddressvila formosalat-2213438606262207lng-51397117614746094number931additionaladdressurladdresses824517typeavenidanameonze5
formosalat-2213438606262207lng-51397117614746094number931additionaladdressurladdresses824517typeavenidanameonze de maiozip19050050neighborhoodvila5
maiozip19050050neighborhoodvila formosaneighborhoodshortvl formosastatespcitypresidente5
no topo da5
avillage imveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96-logo20-20a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9-logo20-20a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber18 3908-7172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber185
formosastatespcitypresidente prudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontato para4
casas venda porto4
prudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontato para imveis4
casas venda jardim4
venda porto madero4
formosaneighborhoodshortvl formosastatespcitypresidente prudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontato4
apartamentos para alugar4
dvidasu003cdivu003cau003cdivcodejavascriptnullcondopagetruedefaultscopenullfaviconurlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxs7danjuev7tewtj5tet1ozqgzm1jnjavufrcjadqk2nyq4sn9uzultlp41e0ii0wvb63pyib08lpto-d9go937x4npydrbfez57sdugfwutqsiuqdrstury0xzboajhewyvi7cnyyb-zxw-gdpajrhdjanmkxoyd4dngohflyi3nednso9blmc4dfghvfajpgfaviconuselogotipotruegooglemapspublickeyaizasydq9qbnewxtbxqtm91rbljwrbvrms-xee4googletagmanagernullgoogletranslatefalsegoogleuanullimgapiurlhttpsimgskenloioingaiaadsfalseingaiaadscalltrackingnullingaiaadsparamsnullingaiaadsuidnullingaiacampusurlnullingaiacapitalgenericfalseingaiacapitallistingfalseaccountnulldigitalrentalfalseleadsapiurlhttpleadsingaiacombrleadsingaialistingsownonlyfalselockedversion2logotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbbgosbt9ro1zjks-yncilnlxpdkzsucvzkpvmzhgt-gi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip-9hw-yvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgmetadescriptionimob a village3
melhor negcio para3
onze de maio3
ofertas de crdito3
o melhor negcio3
encontraremos o melhor3
ns encontraremos o3
conosco ns encontraremos3
voc financiar seu3
para voc financiar3
crdito para voc3
ns avisaremos quando3
e ns avisaremos3
procura e ns3
voc procura e3
que voc procura3
imvel que voc3
o imvel que3
negciofeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeimoveistabsfalselayout12placeholderlanamentos em destaquefeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeempreendimentostabsfalselayout10placeholdermais3
u003cspan u003cspan u003cp3
casas venda22
village imveis22
imveis s22
s s22
s ltda22
ltda me18
para imveis14
venda e12
para venda12
imovis para12
me imovis12
u003ctd u003ctr11
venda parque10
u003ctr u003ctbody10
localizado no10
u003ctbody u003ctable10
parque residencial10
u003cdiv u003ctd9
01899660-7172 ambos7
venda 01899660-71727
contato para7
e contato7
01899155-9417 e7
aluguel 01899155-94177
u003ctable u003cdiv7
residencial damha7
gecko chrome610314306
me imoveis6
khtml like6
applewebkit53736 khtml6
wow64 applewebkit537366
63 wow646
nt 636
windows nt6
venda porto6
like gecko6
locao apartamentos6
venda locao6
imobiliria venda6
corretores imobiliria6
imoveis corretores6
ambos whatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjks-yncilnlxpdkzsucvzkpvmzhgt-gi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip-9hw-yvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhfl-hpy3r-wpsl805m2zrl4rj4mnbeu7a-ttkgwojtvibb9h7rxl7zlvx-8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8cz-yk8viqhhdnx2r2ar-wwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177-cgpsfalsecurrentlanguagept-breditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeen-ustitleenglishcodept-brtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdata-apiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla505
whatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjks-yncilnlxpdkzsucvzkpvmzhgt-gi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip-9hw-yvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhfl-hpy3r-wpsl805m2zrl4rj4mnbeu7a-ttkgwojtvibb9h7rxl7zlvx-8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8cz-yk8viqhhdnx2r2ar-wwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177-cgpsfalsecurrentlanguagept-breditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeen-ustitleenglishcodept-brtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdata-apiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla50 windows5
para alugar5
imveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96-logo20-20a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9-logo20-20a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber18 3908-7172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber185
formosaneighborhoodshortvl formosastatespcitypresidente5
maiozip19050050neighborhoodvila formosaneighborhoodshortvl5
e locaometakeywordsimob5
apartamentos casasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenu5
casasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenu superior5
superior localizado5
no topo5
topo da5
da pginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenu5
pginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenu inferior5
inferior localizado5
no rodap5
rodap da5
da pginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfa5
pginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfa fa-laptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfa5
fa-laptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfa fa-homepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfa5
fa-homepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfa fa-bookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfa5
fa-bookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfa fa-phonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliria5
fa-phonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliria avillage5
avillage imveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96-logo20-20a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9-logo20-20a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber185
3908-7172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber18 3908-7273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber185
3908-7273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber18 99155-9417suffixcarriertimwhatsapptrueshowtruemainfalsedisplayaddressvila5
99155-9417suffixcarriertimwhatsapptrueshowtruemainfalsedisplayaddressvila formosalat-2213438606262207lng-51397117614746094number931additionaladdressurladdresses824517typeavenidanameonze5
apartamentos para4
porto madero4
terrenos venda4
venda jardim4
windowmarkovars windowmarkovars4
formosastatespcitypresidente prudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontato4
prudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontato para4
windowmarkosections windowmarkosections4
para voc3
procura e3
u003cspan u003cspan3
negciofeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeimoveistabsfalselayout12placeholderlanamentos em3
em destaquefeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeempreendimentostabsfalselayout10placeholdermais3
suas dvidasu003cdivu003cau003cdivcodejavascriptnullcondopagetruedefaultscopenullfaviconurlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxs7danjuev7tewtj5tet1ozqgzm1jnjavufrcjadqk2nyq4sn9uzultlp41e0ii0wvb63pyib08lpto-d9go937x4npydrbfez57sdugfwutqsiuqdrstury0xzboajhewyvi7cnyyb-zxw-gdpajrhdjanmkxoyd4dngohflyi3nednso9blmc4dfghvfajpgfaviconuselogotipotruegooglemapspublickeyaizasydq9qbnewxtbxqtm91rbljwrbvrms-xee4googletagmanagernullgoogletranslatefalsegoogleuanullimgapiurlhttpsimgskenloioingaiaadsfalseingaiaadscalltrackingnullingaiaadsparamsnullingaiaadsuidnullingaiacampusurlnullingaiacapitalgenericfalseingaiacapitallistingfalseaccountnulldigitalrentalfalseleadsapiurlhttpleadsingaiacombrleadsingaialistingsownonlyfalselockedversion2logotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbbgosbt9ro1zjks-yncilnlxpdkzsucvzkpvmzhgt-gi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip-9hw-yvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgmetadescriptionimob3
o imvel3
imvel que3
que voc3
voc procura3
e ns3
voc financiar3
ns avisaremos3
avisaremos quando3
melhores ofertas3
crdito para3
negcio para3
melhor negcio3
o melhor3
encontraremos o3
ns encontraremos3
conosco ns3
financiar seu3
u003cspan u003cp3
venda54
s45
para38
imveis37
e27
casas22
village22
ltda22
seu20
me18
no12
residencial12
imovis12
u003ctr11
u003ctd11
da10
u003cdiv10
u003ctable10
u003ctbody10
parque10
apartamentos10
if10
localizado10
voc8
avillage8
o8
u003cspan8
windowmarkosections8
windowmarkovars8
u003cp8
ambos7
damha7
01899660-71727
locao7
contato7
01899155-94177
aluguel7
em7
wow646
nt6
06
16
applewebkit537366
khtml6
gecko6
windows6
ns6
jardim6
porto6
26
chrome610314306
like6
plural6
suas6
imoveis6
corretores6
imobiliria6
vila5
pginasectionsuidb0cede7fbb62e85d8e1eb2f5f6a4725etitleinstitucionaliconfa5
rodap5
inferior5
pginasectionsnullallowlinktruemax3nav2uidconfignav2titlerodapdescriptionmenu5
alugar5
superior5
topo5
width5
fa-homepages580275802886411linkmodegroupuid354da906839a2fb060d15e6c75ea6583titleserviosiconfa5
casasnamehttpwwwavillageimoveiscombrnav1uidconfignav1titlesuperiordescriptionmenu5
locaometakeywordsimob5
endif5
fa-laptoppagesnulllinkmodegroupuid32d2d6a0c0678c665859af3faa48b657titleimveisiconfa5
whatsapptoptemplateidtheme08toptemplateurlnulllogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbfgosbt9ro1zjks-yncilnlxpdkzsucvzkpvmzhgt-gi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip-9hw-yvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgnamebasicfooterstyledefault1headerstylefilledoverlayfalseoverlaycolorsecondaryoverlayopacity08banneroverlayopacity08phonesstylenulltopfullscreenfalsetoplogotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1szbgxtlvgosbxp7jb3tausvq7iylq0m1nnxk6ubhfl-hpy3r-wpsl805m2zrl4rj4mnbeu7a-ttkgwojtvibb9h7rxl7zlvx-8uzyyobm77ce8jlevqb96fc0snf2bu4inrmlh0wyvd3dz3ymrmpw9xirqeoybk5y8cz-yk8viqhhdnx2r2ar-wwmjn6eqdadbrujpgtoptextcolordarkvideourlnullserverassetsurlhttpsingaiasitess3amazonawscomassets1177-cgpsfalsecurrentlanguagept-breditmodefalsesafemodefalsemobilemodefalseavailablelanguagescodeen-ustitleenglishcodept-brtitleportuguesemessageapiurlhttpsmessagingapikenloioapimessagewebsocketurlhttpsmessagingapikenloionotificationapiurlhttpsnotificationapikenloiov1authorizationapiurlkenlohttpsauthorizationapikenloioauthorizationapiurlhttpsusersdata-apiingaiacombrhosthttpwwwavillageimoveiscombruseragentmozilla505
maiozip19050050neighborhoodvila5
fa-bookpages58029linkmodegroupuid935b3e9a66ada54511af4e2e9ab84d06titlecontatoiconfa5
fa-phonepages58030linkmodegroupmax4newslettershownullnewslettertosemailmarcelovillageimoveishotmailcompagespeedskipfalseplanfreereadytruerecaptchaprivatekeynullrecaptchapublickeynullsearchbysecondaryreferencetrueshowbrokerinfotrueshowbrokerpagetrueshowbrokerstrueshowcondowithtabsalefalsesocialblogurlnullsocialfacebookurlnullsocialgoogleplusurlnullsocialinstagramurlnullsociallinkedinurlnullsocialpinteresturlnullsocialtwitterurlnullsocialyoutubeurlnullssotenantnullthemebasictitleimobiliria5
imvel5
formosastatespcitypresidente5
imveistoplogotipourlhttpscdn1valuegaiacombrgaiasite39022temalogotiposite09219fe96f3927210b253f5e22954f96-logo20-20a20villagejpgtypeagencywatermarkopacity02watermarkpositionswwatermarkshowtruewatermarkurlhttpscdn1valuegaiacombrgaiasitewatermark390229943286238ae8666eceafadecdb21de9-logo20-20a20villagejpgwebhooksmatomositeid3003accountclientidnulloverwriteshowmapfalseprioritizeagencyfalseredirecturlnullsignaturenullsuggestionsnullfavoritesnullvisitsnulloffersnullratingsnullmessagesnullnotificationsnullingaiabotplanstatustrialingaiabottrialexpiredfalseofficesnamematrizphonestypecommercialprefixnullnumber185
3908-7172suffixnullcarriervivowhatsappfalseshowtruemaintruetypecommercialprefixnumber185
formosaneighborhoodshortvl5
3908-7273suffixcarriervivowhatsappfalseshowtruemainfalsetypecommercialprefixnumber185
formosalat-2213438606262207lng-51397117614746094number931additionaladdressurladdresses824517typeavenidanameonze5
99155-9417suffixcarriertimwhatsapptrueshowtruemainfalsedisplayaddressvila5
u003cstyle4
prudentecountrybrasilmaintruevisibletrueshowfulladdressnullcid41859themecolorprimaryec1f25colorprimarytextfffcolorsecondary223d96colorsecondarytextfffcontrastlightfooterlogourlnullfootertextcontato4
else4
madero4
function4
terrenos4
negciofeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeimoveistabsfalselayout12placeholderlanamentos3
destaquefeaturestitledestaquesfiltersdestaque1statuscomercial2activetruetypeempreendimentostabsfalselayout10placeholdermais3
melhores3
abaixo3
field3
field03
endfor3
residenceu003cau003cliu003ci3
presidente3
dvidasu003cdivu003cau003cdivcodejavascriptnullcondopagetruedefaultscopenullfaviconurlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxs7danjuev7tewtj5tet1ozqgzm1jnjavufrcjadqk2nyq4sn9uzultlp41e0ii0wvb63pyib08lpto-d9go937x4npydrbfez57sdugfwutqsiuqdrstury0xzboajhewyvi7cnyyb-zxw-gdpajrhdjanmkxoyd4dngohflyi3nednso9blmc4dfghvfajpgfaviconuselogotipotruegooglemapspublickeyaizasydq9qbnewxtbxqtm91rbljwrbvrms-xee4googletagmanagernullgoogletranslatefalsegoogleuanullimgapiurlhttpsimgskenloioingaiaadsfalseingaiaadscalltrackingnullingaiaadsparamsnullingaiaadsuidnullingaiacampusurlnullingaiacapitalgenericfalseingaiacapitallistingfalseaccountnulldigitalrentalfalseleadsapiurlhttpleadsingaiacombrleadsingaialistingsownonlyfalselockedversion2logotipourlhttpsimgskenloiovwrcukq2tnp3d1bjrdbjve1s0xgxsbbgosbt9ro1zjks-yncilnlxpdkzsucvzkpvmzhgt-gi0vqftypvh7xy3icsfufjl7xhdhmkoyvkw6mcx17tqnov84vjeyoqzknflip-9hw-yvfu0hin9ahhzpbqhs0hnbd3rysrf8mfjgmliapycgy8yhvkb3u0inqdebgd2hgywy7vt7nb4hztflujpgmetadescriptionimob3
mais3
crdito3
financiar3
uma3
conosco3
encontraremos3
melhor3
negcio3
quando3
maio3
avisaremos3
residence3
procura3
que3
sob3
ofertas3
onze3
bongiovani3

Avillageimoveis.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Avilla-sport.com
Frizbi - Naslovna
Avilla.jp
アヴィラ公式/AVILLA OFFICIAL
Avillachamber.org
Your Community. Your Future. Together We Can Make A Difference - Avilla Indiana Chamber of Commerce
Avillaconstruction.com
Avilla Construction
Avillafan.com
avillafan.com - AVFC - Aston Villa Fansite, blog & forum.
Avillage.ru
Не опубликован
Avillagecalledversailles.com
A Village Called Versailles
Avillagecluster.com
A Village Cluster

Recently Updated Websites

Sunniestway.com 2 seconds ago.Gtran.com 3 seconds ago.Shanefarrlaw.com 4 seconds ago.Braincore-solutions.com 4 seconds ago.Topkoupelny.cz 4 seconds ago.Effectivesoft.com 4 seconds ago.Dranik.info 5 seconds ago.Rv-eicherhof.de 5 seconds ago.Bowenstudy.com 5 seconds ago.Jiajule88.com 5 seconds ago.Sanita.ro 6 seconds ago.Omahacash4homes.com 7 seconds ago.Threesixtymidtown.com 8 seconds ago.Bandaocoffee.com 8 seconds ago.Medicrelocation.com 9 seconds ago.Thesilentwhite.com 9 seconds ago.Instahashtags.com 10 seconds ago.Safeandvaultlocks.com 10 seconds ago.Otellidelft.nl 10 seconds ago.Illinois-mechanicslien.com 11 seconds ago.Lojnn.com 11 seconds ago.Litmark.ru 11 seconds ago.Fourgottenpaws.com 11 seconds ago.Plantabillion.org.br 12 seconds ago.Cryotechnordic.com 12 seconds ago.Melodyafrique.com 13 seconds ago.Tamano.info 14 seconds ago.Feddprop.com 14 seconds ago.Dcmliferadio.org 14 seconds ago.584kk.com 15 seconds ago.