Avs-yhtiot.fi Favicon Avs-yhtiot.fi

Avs-yhtiot.fi Website Thumbnail
Checking...
AVS-Yhtiöt Oy – Pneumatiikka- ja teollisuusventtiilit
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
avs-yhtiot
Domain extension
fi
Domain registered:
1997-11-24
Domain updated:
2017-06-09
Domain expires:
2021-08-31
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is avs-yhtiot.fi ranked relative to other sites:

Percentage of visits to avs-yhtiot.fi from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Avs-yhtiot.fi registered?
A: Avs-yhtiot.fi was registered 22 years, 11 months, 2 days, 3 hours, 50 minutes, 54 seconds ago on Monday, November 24, 1997.
Q: When was the WHOIS for Avs-yhtiot.fi last updated?
A: The WHOIS entry was last updated 3 years, 4 months, 2 weeks, 3 days, 3 hours, 50 minutes, 54 seconds ago on Friday, June 9, 2017.
Q: What are Avs-yhtiot.fi's nameservers?
A: DNS for Avs-yhtiot.fi is provided by the following nameservers:
  • ns2.wmhost.org
  • ns1.wmhost.org
  • ns3.wmhost.org
Q: Who is the registrar for the Avs-yhtiot.fi domain?
A: The domain has been registered at Finnish Communications Regulatory Authority.
Q: What is the traffic rank for Avs-yhtiot.fi?
A: Avs-yhtiot.fi has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Avs-yhtiot.fi each day?
A: Avs-yhtiot.fi receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Avs-yhtiot.fi resolve to?
A: Avs-yhtiot.fi resolves to the IPv4 address 84.34.147.40.
Q: In what country are Avs-yhtiot.fi servers located in?
A: Avs-yhtiot.fi has servers located in the Finland.
Q: What webserver software does Avs-yhtiot.fi use?
A: Avs-yhtiot.fi is powered by Nginx webserver.
Q: Who hosts Avs-yhtiot.fi?
A: Avs-yhtiot.fi is hosted by AinaCom Oy in Finland.
Q: How much is Avs-yhtiot.fi worth?
A: Avs-yhtiot.fi has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Avs-yhtiot.fi?

Avs-yhtiot.fi Hosting Provider Information

Hosted IP Address:84.34.147.40
Hosted Hostname:www20.zoner.fi
Service Provider:AinaCom Oy
Hosted Country:FinlandFI
Location Latitude:60.1717
Location Longitude:24.9349
Webserver Software:nginx

Is "AinaCom Oy" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Avs-yhtiot.fi

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Mon, 12 Oct 2020 16:13:45 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://www.avs-yhtiot.fi/

Avs-yhtiot.fi Domain Nameserver Information

HostIP AddressCountry
ns2.wmhost.org 52.17.226.71
ns1.wmhost.org 89.166.51.6
ns3.wmhost.org 89.166.51.3


Need to find out who hosts Avs-yhtiot.fi?


WhoIs information for Avs-yhtiot.fi

Avs-yhtiot.fi Free SEO Report

Website Inpage Analysis for Avs-yhtiot.fi

H1 Headings

0 :

H2 Headings

2 :
  1. Ajankohtaista
  2. Päämiehemme ja kumppanimme

H3 Headings

3 :
  1. Pneumatiikka
  2. Teollisuusventtiilit
  3. Paineilmaverkostot

H4 Headings

9 :
  1. Tuotteet
  2. Camozzi jatkaa toimintaansa Covid-19 -epidemian aikana – mukana taudin vastaisessa taistelussa
  3. Avainlippu-merkki AVS:n sylinterituotannolle
  4. Halogeenivapaat moniputki- ja yhdistelmäkaapelit
  5. Haponkestävien liittimien valikoimamme laajenee
  6. Kompaktit AVA-sähkötoimilaitteet
  7. RAASM letkukelat happikäyttöön
  8. Open Frame Controller Industry 4.0 -sovelluksiin
  9. Tutustu AVS:n paineilmaverkostot-tuotteisiin

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

43 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-107113316-1

Links - Internal

195:
  1. No text
    https://www.avs-yhtiot.fi/
  2. Yritys
    https://www.avs-yhtiot.fi/yritys/
  3. PNEUMATIIKKA
    https://www.avs-yhtiot.fi/pneumatiikka/
  4. Sylinterit
    http://avs-yhtiot.fi/sylinterit/
  5. Pyörösylinterit
    http://avs-yhtiot.fi/tuotteet/pyorosylinterit/
  6. Lyhytrakennesylinterit
    http://avs-yhtiot.fi/tuotteet/lyhytrakennesylinterit/
  7. ISO/VDMA-sylinterit
    http://avs-yhtiot.fi/tuotteet/vdma-sylinterit/
  8. Varrettomat sylinterit
    http://avs-yhtiot.fi/tuotteet/varrettomat-sylinterit/
  9. Vääntösylinterit
    http://avs-yhtiot.fi/tuotteet/vaantosylinterit/
  10. Ruostumattomat sylinterit
    http://avs-yhtiot.fi/tuotteet/ruostumattomat-sylinterit/
  11. Paineilmarasiat
    http://avs-yhtiot.fi/tuotteet/paineilmarasiat/
  12. Asemointisylinterit
    http://avs-yhtiot.fi/tuotteet/asemointisylinterit/
  13. Sylinterivarusteet
    http://avs-yhtiot.fi/tuotteet/sylinterivarusteet/
  14. Sähköinen liike
    http://avs-yhtiot.fi/tuotteet/sahkoinen-liike/
  15. Sylinteriohjeita
    http://avs-yhtiot.fi/tuotteet/sylinteriohjeita/
  16. Pneumatiikkaventtiilit
    http://avs-yhtiot.fi/tuotteet/pneumatiikkaventtiilit/
  17. Servo- ja proportionaalituotteet
    http://avs-yhtiot.fi/tuotteet/servo-ja-proportionaalituotteet/
  18. Suoraohjatut mg-venttiilit
    http://avs-yhtiot.fi/tuotteet/suoraohjatut-mg-venttiilit/
  19. Putkistoasenteiset suuntaventtiilit
    http://avs-yhtiot.fi/tuotteet/putkistoasenteiset-suuntaventtiilit/
  20. Putkisto- ja pohjalaatta-as. suuntaventtiilit
    http://avs-yhtiot.fi/tuotteet/putkisto-ja-pohjalaatta-as-suuntaventtiilit/
  21. Pohjalaatta-as. suuntaventtiilit
    http://avs-yhtiot.fi/tuotteet/pohjalaatta-as-suuntaventtiilit/
  22. Mekaanisesti ohjatut venttiilit
    http://avs-yhtiot.fi/tuotteet/mekaanisesti-ohjatut-venttiilit/
  23. Lihasohjatut venttiilit
    http://avs-yhtiot.fi/tuotteet/lihasohjatut-venttiilit/
  24. Namur-venttiilit
    http://avs-yhtiot.fi/tuotteet/namur-venttiilit/
  25. Venttiiliterminaalit
    http://avs-yhtiot.fi/tuotteet/venttiiliterminaalit/
  26. Erikoisventtiilit
    http://avs-yhtiot.fi/tuotteet/erikoisventtiilit/
  27. Tarvikeventtiilit
    http://avs-yhtiot.fi/tuotteet/tarvikeventtiilit/
  28. Venttiilivarusteet
    http://avs-yhtiot.fi/tuotteet/venttiilivarusteet/
  29. Mg-venttiilit nesteille ja kaasuille
    http://avs-yhtiot.fi/tuotteet/mg-venttiilit-nesteille-ja-kaasuille/
  30. Painekytkimet
    http://avs-yhtiot.fi/tuotteet/painekytkimet/
  31. Venttiiliohjeita
    http://avs-yhtiot.fi/tuotteet/venttiiliohjeita/
  32. Huoltolaitteet
    http://avs-yhtiot.fi/tuotteet/huoltolaitteet/
  33. Suodattimet
    http://avs-yhtiot.fi/tuotteet/suodattimet/
  34. Paineensäätimet
    http://avs-yhtiot.fi/tuotteet/paineensaatimet/
  35. Voitelulaitteet
    http://avs-yhtiot.fi/tuotteet/voitelulaitteet/
  36. Suodinsäätimet
    http://avs-yhtiot.fi/tuotteet/suodinsaatimet/
  37. Pehmeäkäynnistimet
    http://avs-yhtiot.fi/tuotteet/pehmeakaynnistimet/
  38. Sulkuventtiilit
    http://avs-yhtiot.fi/tuotteet/sulkuventtiilit/
  39. Huoltolaitevarusteet
    http://avs-yhtiot.fi/tuotteet/huoltolaitevarusteet/
  40. FRL-ryhmäasennus
    http://avs-yhtiot.fi/tuotteet/frl-ryhmaasennus/
  41. FRL-ohjeet
    http://avs-yhtiot.fi/tuotteet/frl-ohjeet/
  42. Liittimet
    http://avs-yhtiot.fi/tuotteet/liittimet/
  43. Pistoliittimet
    http://avs-yhtiot.fi/tuotteet/pistoliittimet/
  44. Mutteriliittimet
    http://avs-yhtiot.fi/tuotteet/mutteriliittimet/
  45. Helmiliittimet
    http://avs-yhtiot.fi/tuotteet/helmiliittimet/
  46. Pikaliittimet
    http://avs-yhtiot.fi/tuotteet/pikaliittimet/
  47. Asennustarvikkeet
    http://avs-yhtiot.fi/tuotteet/asennustarvikkeet/
  48. Leikkuurengasliittimet
    http://avs-yhtiot.fi/tuotteet/leikkuurengasliittimet/
  49. Puristusrengasliittimet
    http://avs-yhtiot.fi/tuotteet/puristusrengasliittimet/
  50. Jakotukit
    http://avs-yhtiot.fi/tuotteet/jakotukit/
  51. Putket ja kaapelit
    http://avs-yhtiot.fi/tuotteet/putket-ja-liittimet/
  52. Pneumatiikkaputket
    http://avs-yhtiot.fi/tuotteet/pneumatiikkaputket
  53. Ajoneuvoputket
    http://avs-yhtiot.fi/tuotteet/ajoneuvoputket
  54. Yhdistelmäputket
    http://avs-yhtiot.fi/tuotteet/yhdistelmaputket
  55. Erikoisputket
    http://avs-yhtiot.fi/tuotteet/erikoisputket
  56. Moni- ja yhdistelmäkaapelit
    http://avs-yhtiot.fi/tuotteet/moni-ja-yhdistelmakaapelit
  57. Spiraalit ja yhdistelmäspiraalit
    http://avs-yhtiot.fi/tuotteet/spiraalit-ja-yhdistelmaspiraalit
  58. Paineilmaletkut
    http://avs-yhtiot.fi/tuotteet/paineilmaletkut
  59. Muovilaatujen ominaisuuksia
    http://avs-yhtiot.fi/tuotteet/muovilaatujen-ominaisuuksia
  60. Robotiikka
    http://avs-yhtiot.fi/tuotteet/robotiikka/
  61. Tarttujat
    http://avs-yhtiot.fi/tuotteet/tarttujat/
  62. Lineaariyksiköt
    http://avs-yhtiot.fi/tuotteet/lineaariyksikot/
  63. Kääntöyksiköt
    http://avs-yhtiot.fi/tuotteet/kaantoyksikot/
  64. Luistit
    http://avs-yhtiot.fi/tuotteet/luistit/
  65. Alipainetekniikka
    http://avs-yhtiot.fi/tuotteet/alipainetekniikka/
  66. Perusohjelma
    http://avs-yhtiot.fi/tuotteet/perusohjelma/
  67. Imukupit
    http://avs-yhtiot.fi/tuotteet/imukupit/
  68. Alipaineventtiilit
    http://avs-yhtiot.fi/tuotteet/alipaineventtiilit/
  69. Huoltolaitteet ja varusteet
    http://avs-yhtiot.fi/tuotteet/huoltolaitteet-ja-varusteet/
  70. Liittimet ja letkut
    http://avs-yhtiot.fi/tuotteet/liittimet-ja-letkut/
  71. Alipainepumput
    http://avs-yhtiot.fi/tuotteet/alipainepumput/
  72. Ejektorit
    http://avs-yhtiot.fi/tuotteet/ejektorit/
  73. Octopus-järjestelmä
    http://avs-yhtiot.fi/tuotteet/octopus-jarjestelma/
  74. Erikoistuotteet
    http://avs-yhtiot.fi/tuotteet/erikoistuotteet/
  75. AISI-Pneumatiikka
    http://avs-yhtiot.fi/tuotteet/aisi-pneumatiikka/
  76. Sylinterit
    http://avs-yhtiot.fi/tuotteet/sylinterit-2/
  77. Ohjausventtiilit
    http://avs-yhtiot.fi/tuotteet/ohjausventtiilit/
  78. Suodatinkomponentit
    http://avs-yhtiot.fi/tuotteet/suodatinkomponentit/
  79. Säiliöt
    http://avs-yhtiot.fi/tuotteet/sailiot/
  80. Pulssiventtiilit
    http://avs-yhtiot.fi/tuotteet/pulssiventtiilit/
  81. Ohjaimet
    http://avs-yhtiot.fi/tuotteet/ohjaimet/
  82. Varusteet
    http://avs-yhtiot.fi/tuotteet/varusteet/
  83. Toimialakohtaiset ratkaisut
    http://avs-yhtiot.fi/tuotteet/toimialakohtaiset-ratkaisut/
  84. Pneumatiikan ohjeita
    http://avs-yhtiot.fi/tuotteet/pneumatiikan-ohjeita/
  85. Pneumatiikan sertifikaatteja
    http://avs-yhtiot.fi/tuotteet/pneumatiikan-sertifikaatteja/
  86. Camozzi-tuoteluettelot
    https://www.avs-yhtiot.fi/tuotteet/camozzi-tuoteluettelot/
  87. Teollisuusventtiilit
    https://www.avs-yhtiot.fi/teollisuusventtiilit/
  88. Palloventtiilit
    http://avs-yhtiot.fi/tuotteet/palloventtiilit/
  89. Palloventtiilit haponkestävää terästä
    http://avs-yhtiot.fi/tuotteet/palloventtiilit-haponkestavaa-terasta/
  90. Palloventtiilit terästä
    http://avs-yhtiot.fi/tuotteet/palloventtiilit-terasta/
  91. Palloventtiilit valurautaa
    http://avs-yhtiot.fi/tuotteet/palloventtiilit-valurautaa/
  92. Palloventtiilit messinkiä
    http://avs-yhtiot.fi/tuotteet/palloventtiilit-messinkia/
  93. Erikoispalloventtiilit
    http://avs-yhtiot.fi/tuotteet/erikoispalloventtiilit/
  94. Läppäventtiilit
    http://avs-yhtiot.fi/tuotteet/lappaventtiilit/
  95. Pehmeätiivisteiset läppäventtiilit
    http://avs-yhtiot.fi/tuotteet/pehmeatiivisteiset-lappaventtiilit/
  96. Teflonvuoratut läppäventtiilit
    http://avs-yhtiot.fi/tuotteet/teflonvuoratut_lappaventtiilit/
  97. Kaksoisepäkeskeiset läppäventtiilit
    https://www.avs-yhtiot.fi/tuotteet/kaksoisepakeskeiset_lappaventtiilit/
  98. Kolmoisepäkeskeiset läppäventtiilit
    http://avs-yhtiot.fi/tuotteet/kolmoisepakeskeiset_lappaventtiilit/
  99. Toimilaitteet
    http://avs-yhtiot.fi/tuotteet/toimilaitteet/
  100. Pneumaattiset toimilaitteet
    http://avs-yhtiot.fi/tuotteet/pneumaattiset-toimilaitteet/
  101. Ruuvitoimilaitteet
    http://avs-yhtiot.fi/tuotteet/ruuvitoimilaitteet/
  102. Sähkötoimilaitteet
    http://avs-yhtiot.fi/tuotteet/sahkotoimilaitteet/
  103. Rajakytkimet
    http://avs-yhtiot.fi/tuotteet/rajakytkimet/
  104. Asennoittimet
    http://avs-yhtiot.fi/tuotteet/asennoittimet/
  105. Toimilaitevarusteet
    http://avs-yhtiot.fi/tuotteet/toimilaitevarusteet/
  106. Luistiventtiilit
    http://avs-yhtiot.fi/tuotteet/luistiventtiilit/
  107. Levyluistiventtiilit
    http://avs-yhtiot.fi/tuotteet/levyluistiventtiilit/
  108. Kumiluistiventtiilit
    http://avs-yhtiot.fi/tuotteet/kumiluistiventtiilit/
  109. Kiilaluistiventtiilit
    http://avs-yhtiot.fi/tuotteet/kiilaluistiventtiilit/
  110. Istukkaventtiilit
    http://avs-yhtiot.fi/tuotteet/istukkaventtiilit/
  111. Laipalliset istukkaventtiilit
    http://avs-yhtiot.fi/tuotteet/laipalliset-istukkaventtiilit/
  112. Hitsattavat istukkaventtiilit
    http://avs-yhtiot.fi/tuotteet/hitsattavat-istukkaventtiilit/
  113. Kierteelliset istukkaventtiilit
    http://avs-yhtiot.fi/tuotteet/kierteelliset-istukkaventtiilit/
  114. Toimilaitteelliset istukkaventtiilit
    http://avs-yhtiot.fi/tuotteet/toimilaitteelliset-istukkaventtiilit/
  115. Takaiskuventtiilit
    http://avs-yhtiot.fi/tuotteet/takaiskuventtiilit/
  116. Lautastakaiskuventtiilit
    http://avs-yhtiot.fi/tuotteet/lautastakaiskuventtiilit/
  117. Läppätakaiskuventtiilit
    http://avs-yhtiot.fi/tuotteet/lappatakaiskuventtiilit/
  118. Pallotakaiskuventtiilit
    http://avs-yhtiot.fi/tuotteet/pallotakaiskuventtiilit/
  119. Kierteelliset takaiskuventtiilit
    http://avs-yhtiot.fi/tuotteet/kierteelliset-takaiskuventtiilit/
  120. Varoventtiilit
    http://avs-yhtiot.fi/tuotteet/varoventtiilit/
  121. Korkea- ja matalanousuiset varoventtiilit
    http://avs-yhtiot.fi/tuotteet/korkea-ja-matalanousuiset-varoventtiilit/
  122. Ylipaine- ja alipainevaroventtiilit
    http://avs-yhtiot.fi/ylipaine-ja-alipainevaroventtiilit/
  123. Magneettiventtiilit
    http://avs-yhtiot.fi/tuotteet/magneettiventtiilit/
  124. Suoraohjatut magneettiventtiilit
    http://avs-yhtiot.fi/tuotteet/suoraohjatut-magneettiventtiilit/
  125. Apuohjatut magneettiventtiilit
    http://avs-yhtiot.fi/tuotteet/apuohjatut-magneettiventtiilit/
  126. Pakko-ohjatut magneettiventtiilit
    http://avs-yhtiot.fi/tuotteet/pakko-ohjatut-magneettiventtiilit/
  127. ODE magneettiuventtiilit ja kelat
    https://www.avs-yhtiot.fi/tuotteet/ode-magneettiventtiilit-ja-kelat/
  128. Muut teollisuusventtiilit
    http://avs-yhtiot.fi/tuotteet/muut-teollisuusventtiilit/
  129. Letkuventtiilit
    http://avs-yhtiot.fi/tuotteet/letkuventtiilit/
  130. Neulaventtiilit
    http://avs-yhtiot.fi/tuotteet/neulaventtiilit/
  131. Painemittariventtiilit
    http://avs-yhtiot.fi/tuotteet/painemittariventtiilit/
  132. Mudanerottimet
    http://avs-yhtiot.fi/tuotteet/mudanerottimet/
  133. Venttiiliohjeita
    http://avs-yhtiot.fi/tuotteet/venttiiliohjeita-2/
  134. Venttiilien sertifikaatteja
    http://avs-yhtiot.fi/tuotteet/venttiilien-sertifikaatteja/
  135. Paineilmaverkostot
    https://www.avs-yhtiot.fi/paineilmaverkostot/
  136. Paineilman tuottaminen
    http://avs-yhtiot.fi/tuotteet/paineilman-tuottaminen/
  137. Voidellut kompressorit
    http://avs-yhtiot.fi/tuotteet/voidellut-kompressorit/
  138. Öljyttömät kompressorit
    http://avs-yhtiot.fi/tuotteet/oljyttomat-kompressorit/
  139. Kompressorivarusteet
    http://avs-yhtiot.fi/tuotteet/kompressorivarusteet/
  140. Paineilmajärjestelmät
    http://avs-yhtiot.fi/tuotteet/paineilmajarjestelmat/
  141. Paineilman käsittely
    http://avs-yhtiot.fi/tuotteet/paineilman-kasittely/
  142. Apuenergian tuottaminen
    http://avs-yhtiot.fi/tuotteet/apuenergian-tuottaminen/
  143. Pintakäsittelylaitteet
    http://avs-yhtiot.fi/tuotteet/pintakasittelylaitteet/
  144. Huoltamolaitteet
    http://avs-yhtiot.fi/tuotteet/huoltamolaitteet/
  145. Paineilmatyökalut
    http://avs-yhtiot.fi/tuotteet/paineilmatyokalut/
  146. Ohjeet
    http://avs-yhtiot.fi/tuotteet/ohjeet/
  147. Palvelut
    https://www.avs-yhtiot.fi/palvelut/
  148. Ajankohtaista
    https://www.avs-yhtiot.fi/ajankohtaista/
  149. Materiaali
    https://www.avs-yhtiot.fi/materiaali/
  150. Yhteys
    https://www.avs-yhtiot.fi/yhteys/
  151. EN
    https://www.avs-yhtiot.fi/en/
  152. Etusivu
    https://www.avs-yhtiot.fi/
  153. Pneumatiikka
    https://www.avs-yhtiot.fi/pneumatiikka/
  154. Suomalaista osaamista jo vuodesta 1979
    http://avs-yhtiot.fi/yritys#osaamista
  155. AVS - paras yhteistyökumppanisi
    http://avs-yhtiot.fi/yritys#paras
  156. Laaja tuotevalikoima ja oma tuotanto takaavat palvelun joustavuuden
    http://avs-yhtiot.fi/yritys#tuotevalikoima
  157. Lue lisää >>> 
    https://www.avs-yhtiot.fi/yritys/
  158. No text
    http://avs-yhtiot.fi/pneumatiikka/
  159. No text
    http://avs-yhtiot.fi/teollisuusventtiilit/
  160. No text
    http://avs-yhtiot.fi/paineilmaverkostot/
  161. TILAA UUTISKIRJEEMME
    http://avs-yhtiot.fi/uutiskirjetilaus/
  162. OTA YHTEYTTÄ
    http://avs-yhtiot.fi/yhteys/
  163. No text
    https://www.avs-yhtiot.fi/camozzi-konsernin-yritykset-jatkavat-toimintaansa-covid-19-epidemian-aikana-mukana-taudin-vastaisessa-taistelussa/
  164. Camozzi jatkaa toimintaansa Covid-19 -epidemian aikana – mukana taudin vastaisessa taistelussa
    https://www.avs-yhtiot.fi/camozzi-konsernin-yritykset-jatkavat-toimintaansa-covid-19-epidemian-aikana-mukana-taudin-vastaisessa-taistelussa/
  165. Esa Petterson
    https://www.avs-yhtiot.fi/author/esa/
  166. Pneumatiikka
    https://www.avs-yhtiot.fi/kategoria/pneumatiikka/
  167. Yleinen
    https://www.avs-yhtiot.fi/kategoria/yleinen/
  168. Lue lisää
    https://www.avs-yhtiot.fi/camozzi-konsernin-yritykset-jatkavat-toimintaansa-covid-19-epidemian-aikana-mukana-taudin-vastaisessa-taistelussa/
  169. No text
    https://www.avs-yhtiot.fi/avainlippu-merkki-avsn-sylinterituotannolle/
  170. Avainlippu-merkki AVS:n sylinterituotannolle
    https://www.avs-yhtiot.fi/avainlippu-merkki-avsn-sylinterituotannolle/
  171. Lue lisää
    https://www.avs-yhtiot.fi/avainlippu-merkki-avsn-sylinterituotannolle/
  172. No text
    https://www.avs-yhtiot.fi/halogeenivapaat-moniputki-ja-yhdistelmakaapelit/
  173. Halogeenivapaat moniputki- ja yhdistelmäkaapelit
    https://www.avs-yhtiot.fi/halogeenivapaat-moniputki-ja-yhdistelmakaapelit/
  174. Lue lisää
    https://www.avs-yhtiot.fi/halogeenivapaat-moniputki-ja-yhdistelmakaapelit/
  175. No text
    https://www.avs-yhtiot.fi/haponkestavien-liittimien-valikoimamme-laajenee/
  176. Haponkestävien liittimien valikoimamme laajenee
    https://www.avs-yhtiot.fi/haponkestavien-liittimien-valikoimamme-laajenee/
  177. Lue lisää
    https://www.avs-yhtiot.fi/haponkestavien-liittimien-valikoimamme-laajenee/
  178. No text
    https://www.avs-yhtiot.fi/kompaktit-ava-sahkotoimilaitteet/
  179. Kompaktit AVA-sähkötoimilaitteet
    https://www.avs-yhtiot.fi/kompaktit-ava-sahkotoimilaitteet/
  180. Teollisuusventtiilit
    https://www.avs-yhtiot.fi/kategoria/teollisuusventtiilit/
  181. Lue lisää
    https://www.avs-yhtiot.fi/kompaktit-ava-sahkotoimilaitteet/
  182. No text
    https://www.avs-yhtiot.fi/raasm-letkukelat-happikayttoon/
  183. RAASM letkukelat happikäyttöön
    https://www.avs-yhtiot.fi/raasm-letkukelat-happikayttoon/
  184. Paineilmaverkostot
    https://www.avs-yhtiot.fi/kategoria/paineilmaverkostot/
  185. Lue lisää
    https://www.avs-yhtiot.fi/raasm-letkukelat-happikayttoon/
  186. No text
    https://www.avs-yhtiot.fi/open-frame-controller-industry-4-0-sovelluksiin/
  187. Open Frame Controller Industry 4.0 -sovelluksiin
    https://www.avs-yhtiot.fi/open-frame-controller-industry-4-0-sovelluksiin/
  188. Lue lisää
    https://www.avs-yhtiot.fi/open-frame-controller-industry-4-0-sovelluksiin/
  189. No text
    https://www.avs-yhtiot.fi/tutustu-avsn-paineilmaverkostot-tuotteisiin/
  190. Tutustu AVS:n paineilmaverkostot-tuotteisiin
    https://www.avs-yhtiot.fi/tutustu-avsn-paineilmaverkostot-tuotteisiin/
  191. Lue lisää
    https://www.avs-yhtiot.fi/tutustu-avsn-paineilmaverkostot-tuotteisiin/
  192. Myyntiehdot
    https://www.avs-yhtiot.fi/myyntiehdot/
  193. Rekisteri- ja tietosuojaseloste
    https://www.avs-yhtiot.fi/rekisteri-ja-tietosuojaseloste/
  194. Tietoa evästeistä
    https://www.avs-yhtiot.fi/tietoa-evasteista/
  195. Lisätietoja
    https://www.avs-yhtiot.fi/

Links - Internal (nofollow)

0:

Links - Outbound

21:
  1. No text
    https://www.linkedin.com/company/avs-yhtiot-oy/
  2. No text
    https://www.abacaircompressors.com/content/abac/en
  3. No text
    https://www.avs-power.fi
  4. No text
    https://www.camozzi.com/
  5. No text
    https://www.exmar.de/en/
  6. No text
    https://www.finicompressors.com/it/
  7. No text
    https://www.hafner-pneumatik.com/
  8. No text
    https://www.hy-lok.eu
  9. No text
    https://www.ktc-air.com/en/homepage.html
  10. No text
    https://www.mmvalve.com
  11. No text
    http://www.marsvalve.com.tw/company.php
  12. No text
    https://www.mgfcompressors.com/home-compressori/
  13. No text
    https://www.nuair.it/index.php/en/
  14. No text
    https://www.raasm.com/en
  15. No text
    http://www.soldo.net/en/
  16. No text
    https://www.tecofi.fr
  17. No text
    http://www.toppi.fi
  18. No text
    https://www.turbocontrols.eu/en/
  19. No text
    http://www.valbia.it
  20. No text
    http://www.vuototecnica.net/companie.php
  21. Havena Oy
    http://www.havena.fi

Links - Outbound (nofollow)

0:

Keyword Cloud for Avs-yhtiot.fi

tuottaminenajankohtaista materiaalilisoyotapaineilmaverkostothtmldiv documentgetelementbyidrspluginsettingsinlinecss ifhtmldivfalseterst palloventtiilitifhtmldivmagneettiventtiiliterrdocumentgetelementsbytagnamehead0appendchildhtmldivchildnodes0 varborder 1pxhtmldivinnerhtml htmldivcss elseesatuotteetpalloventtiilitpneumatiikan1px solid transparentwidthesa petterson pneumatiikkavar htmldiv documentcreateelementdivtruepohjalaattaas suuntaventtiilitdocumentgetelementbyidrspluginsettingsinlinecss ifhtmldiv htmldivinnerhtmldocumentgetelementbyidrspluginsettingsinlinecsshtmldivcenterbackgroundrepeatventtiilit1pxsolid transparentwidthhtmldivcsskompressoritsuuntaventtiilitopenifhtmldiv htmldivinnerhtml htmldivinnerhtmlelse varhtmldivcss else6pxyleinensertifikaattejateollisuusventtiilithtmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0htmldivinnerhtml htmldivinnerhtml htmldivcssja yhdistelmkaapelitelse var htmldivvarusteetpneumatiikkadocumentgetelementbyidrspluginsettingsinlinecss ifhtmldivtransparentwidthajankohtaista materiaali yhteyshtmldivinnerhtml htmldivcssyhdistelmkaapelithtmldiv documentgetelementbyidrspluginsettingsinlinecssborder 1px solidhuoltolaitteetdocumentcreateelementdiv htmldivinnerhtml htmldivcssyritysistukkaventtiilitfalse varavsnlue lishtmldivcss else vartakaiskuventtiilitluebldelhoveroutlinedocumentcreateelementdivpetterson pneumatiikka180pxheightsek1px solidvar htmldivdocumentgetelementsbytagnamehead0appendchildhtmldivchildnodes0 var htmldivcsspistoliittimetsylinteritavsajankohtaistaelseliittimetpalvelut ajankohtaistapaineilmanesa pettersonpohjalaattaashtmldivinnerhtmlmateriaali yhteyshtmldiv documentcreateelementdivhtmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0mgventtiilitdocumentcreateelementdiv htmldivinnerhtmlborderbldstep1el1bldelhtmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0 varvar htmldivcsscenter centerbackgroundrepeattoimilaitteetcenterkierteellisetpettersonjaerr errventtiiliohjeitapalvelut ajankohtaista materiaalilppventtiilitsuoraohjatutoncerevslider41solidterstyhteyshtmldiv documentcreateelementdiv htmldivinnerhtmldocumentgetelementsbytagnamehead0appendchildhtmldivchildnodes0revinitrevslider41ifhtmldiv htmldivinnerhtmlmateriaalivaroventtiilitbldstep1el0htmldivinnerhtml htmldivinnerhtmlvar htmldiv documentgetelementbyidrspluginsettingsinlinecsspalvelutvar

Longtail Keyword Density for Avs-yhtiot.fi

KeywordsOccurences
esa petterson pneumatiikka5
1px solid transparentwidth4
var htmldiv documentcreateelementdiv4
border 1px solid4
htmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
documentcreateelementdiv htmldivinnerhtml htmldivcss4
htmldiv documentcreateelementdiv htmldivinnerhtml4
else var htmldiv4
htmldivcss else var4
htmldivinnerhtml htmldivcss else4
htmldivinnerhtml htmldivinnerhtml htmldivcss4
ifhtmldiv htmldivinnerhtml htmldivinnerhtml4
documentgetelementbyidrs-plugin-settings-inline-css ifhtmldiv htmldivinnerhtml4
htmldiv documentgetelementbyidrs-plugin-settings-inline-css ifhtmldiv4
var htmldiv documentgetelementbyidrs-plugin-settings-inline-css4
ajankohtaista materiaali yhteys3
htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0 var3
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0 var htmldivcss3
palvelut ajankohtaista materiaali3
lue lis9
var htmldiv8
esa petterson8
htmldivinnerhtml htmldivcss8
petterson pneumatiikka5
pohjalaatta-as suuntaventtiilit4
htmldiv documentcreateelementdiv4
solid transparentwidth4
1px solid4
border 1px4
center centerbackground-repeat4
false var4
htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
documentcreateelementdiv htmldivinnerhtml4
else var4
htmldivcss else4
htmldivinnerhtml htmldivinnerhtml4
ifhtmldiv htmldivinnerhtml4
documentgetelementbyidrs-plugin-settings-inline-css ifhtmldiv4
htmldiv documentgetelementbyidrs-plugin-settings-inline-css4
var htmldivcss4
terst palloventtiilit4
ja yhdistelmkaapelit3
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0 var3
materiaali yhteys3
ajankohtaista materiaali3
palvelut ajankohtaista3
err err3
ja40
var37
htmldivinnerhtml12
htmldivcss12
bld-step-1-el-112
bld-step-1-el-012
istukkaventtiilit10
lppventtiilit10
palloventtiilit10
err9
lis9
lue9
pneumatiikka9
esa8
htmldiv8
sylinterit8
magneettiventtiilit8
petterson8
teollisuusventtiilit7
sek6
else6
paineilman6
suuntaventtiilit6
kompressorit5
paineilmaverkostot5
false5
true5
6px5
venttiilit5
avsn4
transparentwidth4
bld-elhoveroutline4
documentgetelementbyidrs-plugin-settings-inline-css4
bld-el4
ifhtmldiv4
documentcreateelementdiv4
180pxheight4
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
solid4
1px4
border4
centerbackground-repeat4
center4
open4
oy4
oncerevslider414
terst4
suoraohjatut4
mg-venttiilit4
pohjalaatta-as4
venttiiliohjeita4
huoltolaitteet4
liittimet4
yhdistelmkaapelit4
varusteet4
pneumatiikan4
sertifikaatteja4
toimilaitteet4
kierteelliset4
takaiskuventtiilit4
varoventtiilit4
tuottaminen4
ajankohtaista4
yritys4
avs4
tuotteet4
revinitrevslider413
yleinen3
ota3
pistoliittimet3
palvelut3
materiaali3
yhteys3

Avs-yhtiot.fi Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Avs-yhtiot.fi is a scam?

Websites with Similar Names

Avs-yhtiot.fi
AVS-Yhtiöt Oy – Pneumatiikka- ja teollisuusventtiilit

Recently Updated Websites

Splatterday.com 1 second ago.360degreessolutions.com 2 seconds ago.Deadwrongkrew.com 4 seconds ago.Eyesightcorner.com 4 seconds ago.Propertymanagementatl.com 4 seconds ago.Harborsouthpoa.com 4 seconds ago.Freital.de 4 seconds ago.Strikegently.co 5 seconds ago.Bahislokal.com 7 seconds ago.Stingersports.com 7 seconds ago.Daytoendimpunity.org 7 seconds ago.Montgomerytheater.org 7 seconds ago.Artlynow.org 9 seconds ago.Daiwa-kougyou.net 9 seconds ago.Tarisyemta.com.tr 9 seconds ago.4unity.net 9 seconds ago.Deathanddesire.com 9 seconds ago.Piech.design 10 seconds ago.Lifecompanion.org 10 seconds ago.Breastcancerconqueror.com 10 seconds ago.Deanwattslaw.com 11 seconds ago.Popmovie.cc 11 seconds ago.Iwasakiseitai.com 13 seconds ago.Siete-palabras.com 13 seconds ago.Dustdevilelectric.com 13 seconds ago.Trademalappuram.com 13 seconds ago.Sxsyajj.com 13 seconds ago.Elitespecialtiesco.com 15 seconds ago.7004999.com 16 seconds ago.Autoescuelaaranda.com 16 seconds ago.