Avsim.suAvsim.su

Add a review Follow site

[28.11.20] 11-14z Practical exam UUWV_CTR. - Avsim.su

Safety: Low trust score

Year Founded: 2008

Global Traffic Rank: 159,742

Estimated Worth: $73,200

Last updated:2020-11-27

Category: Travel > Airlines and Airports

Expand details Change category Claim this site

avsim

Add a review Follow (0)

Domain summary

Domain label	avsim
Domain extension	su
Domain registered:	2008-05-25
Domain updated:	2020-11-27
Domain expires:	2021-05-25
Global Traffic Rank	159,742
Statvoo Rating	F
Trust Score	Low Trust Score
Estimated worth	$73,200
Estimated daily income	$122
Estimated monthly income	$3,711

Rank summary

How is avsim.su ranked relative to other sites:

Percentage of visits to avsim.su from a search engine:

Frequently Asked Questions (FAQ)

Q: When was Avsim.su registered?

A: Avsim.su was registered 12 years, 9 months, 1 week, 9 hours, 51 minutes, 48 seconds ago on Sunday, May 25, 2008.

Q: When was the WHOIS for Avsim.su last updated?

A: The WHOIS entry was last updated 3 months, 4 days, 9 hours, 51 minutes, 48 seconds ago on Friday, November 27, 2020.

Q: What are Avsim.su's nameservers?

A: DNS for Avsim.su is provided by the following nameservers:

norm.ns.cloudflare.com
roxy.ns.cloudflare.com

Q: Who is the registrar for the Avsim.su domain?

A: The domain has been registered at RU-CENTER-REG-RIPN.

Q: What is the traffic rank for Avsim.su?

A: Avsim.su ranks 159,742 globally on Alexa. Avsim.su has a Low Trust Score, and a Statvoo Rank of F.

Q: How many people visit Avsim.su each day?

A: Avsim.su receives approximately 9,768 visitors and 48,840 page impressions per day.

Q: What IP address does Avsim.su resolve to?

A: Avsim.su resolves to the IPv4 address 172.67.72.193.

Q: In what country are Avsim.su servers located in?

A: Avsim.su has servers located in the United States.

Q: What webserver software does Avsim.su use?

A: Avsim.su is powered by CloudFlare webserver.

Q: Who hosts Avsim.su?

A: Avsim.su is hosted by T-Mobile USA, Inc. in United States.

Q: How much is Avsim.su worth?

A: Avsim.su has an estimated worth of $73,200. An average daily income of approximately $122, which is roughly $3,711 per month.

Avsim.su Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Avsim.su Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Avsim.su

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

16 :

Google Adsense

Not Applicable

Google Analytics

UA-7657732-1

Links - Internal

105:

Show 100 more items

Links - Internal (nofollow)

Links - Outbound

Avsim English version →
https://www.avsimrus.com/

Links - Outbound (nofollow)

Keyword Cloud for Avsim.su

5 boeingairbusfunctionairlines5rarr mfs2020quotboeingtrues3mfs2020 5s7rarr fs2004 5quotquotfs20040rarr fs2004a320s7 airlinesvar2rmsmillerrarr mfs2020 51 minusfrarr41nbsprarrupdatepopvideosizerarr flyin vatsimfs2004 5newwidthflyin vatsimmfs2020rarr 5minushttpsminus 1minus 1 minusrarr flyinxplaneflyinvatsim

Longtail Keyword Density for Avsim.su

Keywords	Occurences
minus 1 minus	4
rarr fly-in vatsim	3
rarr fs2004 5	3
rarr mfs2020 5	3
rarr 5	8
minus 1	4
1 minus	4
rarr fs2004	4
rarr fly-in	3
fly-in vatsim	3
s7 airlines	3
fs2004 5	3
rarr mfs2020	3
mfs2020 5	3
5 boeing	3
rarr	31
minus	25
0	19
nbsprarr	10
quotquot	7
x-plane	6
1	6
2	5
var	4
fs2004	4
3	4
airlines	4
airbus	4
function	4
newwidth	4
4	3
a320	3
s	3
https	3
true	3
boeing	3
updatepopvideosize	3
mfs2020	3
rms-miller	3
fly-in	3
vatsim	3
s7	3
5	3
quot	3
f	3

Who hosts Avsim.su?

Avsim.su Hosting Provider Information

Hosted IP Address:	172.67.72.193
Hosted Hostname:	172.67.72.193
Service Provider:	T-Mobile USA, Inc.
Hosted Country:	US
Location Latitude:	37.751
Location Longitude:	-97.822
Webserver Software:	CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name

Percentage

DoD Network Information Center

15.4872%

GoDaddy.com, LLC

9.2224%

Namecheap, Inc.

3.8991%

Google Inc.

2.8555%

Confluence Networks Inc

2.6870%

Amazon.com, Inc.

1.9936%

Merit Network Inc.

1.8570%

1&1 Internet AG

1.8247%

TOT Public Company Limited

1.6908%

Squarespace, Inc.

1.5625%

T-Mobile USA, Inc.

1.2248%

HTTP Header Analysis for Avsim.su

Http-Version:	1.1
Status-Code:	200
Status:	200 OK
Date:	Fri, 27 Nov 2020 15:00:02 GMT
Content-Type:	text/html; charset=UTF-8
Transfer-Encoding:	chunked
Connection:	keep-alive
Access-Control-Allow-Origin:	*
Cache-Control:	no-cache, private
Expires:	Thu, 19 Nov 1981 08:52:00 GMT
Pragma:	no-cache
CF-Cache-Status:	DYNAMIC
cf-request-id:	06abd0f88e0000075a62ba5000000001
Expect-CT:	max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To:	{"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=sItIlQFUOc1aRY5owXLd2E1cNYFIXGM1LBx6OPKcOSJQCQyeRAZPSIKgrOAFqth44jovZNcDlQAN4ZAaXX59jsm8xjZJQm421KPtUug="}],"group":"cf-nel","max_age":604800}
NEL:	{"report_to":"cf-nel","max_age":604800}
Server:	cloudflare
CF-RAY:	5f8cb76da8ec075a-LHR
Content-Encoding:	gzip

Avsim.su Domain Nameserver Information

Host	IP Address	Country
norm.ns.cloudflare.com	173.245.59.134
roxy.ns.cloudflare.com	173.245.58.142

Need to find out who hosts Avsim.su?

Domain Registration (WhoIs) information for Avsim.su

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: AVSIM.SU
descr: E-mail address listed here delivers only messages from NIC.ru. For administrative contact visit:
descr: http://www.avsim.su/contact.phtml
descr: Submit the form and we will get back to you shortly.
nserver: norm.ns.cloudflare.com.
nserver: roxy.ns.cloudflare.com.
state: REGISTERED, DELEGATED
person: Private Person
e-mail: Login to show email
 RUCENTER-SU
created: 2008-05-25T20:00:00Z
paid-till: 2021-05-25T21:00:00Z
free-date: 2021-06-28
source: TCI

Last updated on 2020-11-27T14:56:30Z

Websites with Similar Names

Avsim-bg.org

Avsim.com
AVSIM - The AVSIM Community

Avsim.com.ar
Avsim - Obra Social para Mascotas

Avsim.net
AVSIM - The AVSIM Community

Avsim.su
[28.11.20] 11-14z Practical exam UUWV_CTR. - Avsim.su

Avsima.com
avsima.com | Ücretsiz yapım aşamasında sayfası

Avsima.xyz
avsima.xyz | Ücretsiz yapım aşamasında sayfası

Avsimmigration.in
HOME - Avs Immigration

Avsimpex.trade

Avsimplicity.com
Error 404 (Not Found)!!1

Recently Searched Keywords

united statespublictitle30inches (1 second ago.), viruses amp (13 seconds ago.), objectrequestin (13 seconds ago.), jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (19 seconds ago.), неестественно (19 seconds ago.), lal kitab upay for husband (21 seconds ago.), icollector admin login (26 seconds ago.), 1 sv (28 seconds ago.), skandal (37 seconds ago.), nomad street kid corpo (47 seconds ago.), carousel-75 rpc-content (54 seconds ago.), active 4 lessons (56 seconds ago.), ahover (57 seconds ago.), cmds to see (57 seconds ago.), st dunstans (57 seconds ago.), preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle (1 minute 1 second ago.), vu cua (1 minute 1 second ago.), vng cc n (1 minute 4 seconds ago.), hitogel 45 (1 minute 5 seconds ago.), colorantes para jabones (1 minute 5 seconds ago.), b7 oil gmbh (1 minute 5 seconds ago.), 1 if (1 minute 6 seconds ago.), vng cc (1 minute 6 seconds ago.), vng c nhiu (1 minute 8 seconds ago.), vng c (1 minute 10 seconds ago.), vn n (1 minute 12 seconds ago.), vn chuyn nhanh (1 minute 14 seconds ago.), vn chuyn hng (1 minute 17 seconds ago.), con motore (1 minute 18 seconds ago.), vn chuyn d (1 minute 19 seconds ago.),