[28.11.20] 11-14z Practical exam UUWV_CTR. - Avsim.su

Safety: Low trust score
Year Founded: 2008
Global Traffic Rank: 159,742
Estimated Worth: $73,200
Last updated:2020-11-27


Domain summary

Domain label
avsim
Domain extension
su
Domain registered:
2008-05-25
Domain updated:
2020-11-27
Domain expires:
2021-05-25
Global Traffic Rank
159,742
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$73,200
Estimated daily income
$122
Estimated monthly income
$3,711

Rank summary

How is avsim.su ranked relative to other sites:

Percentage of visits to avsim.su from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Avsim.su registered?
A: Avsim.su was registered 12 years, 9 months, 1 week, 9 hours, 51 minutes, 48 seconds ago on Sunday, May 25, 2008.
Q: When was the WHOIS for Avsim.su last updated?
A: The WHOIS entry was last updated 3 months, 4 days, 9 hours, 51 minutes, 48 seconds ago on Friday, November 27, 2020.
Q: What are Avsim.su's nameservers?
A: DNS for Avsim.su is provided by the following nameservers:
  • norm.ns.cloudflare.com
  • roxy.ns.cloudflare.com
Q: Who is the registrar for the Avsim.su domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Avsim.su?
A: Avsim.su ranks 159,742 globally on Alexa. Avsim.su has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Avsim.su each day?
A: Avsim.su receives approximately 9,768 visitors and 48,840 page impressions per day.
Q: What IP address does Avsim.su resolve to?
A: Avsim.su resolves to the IPv4 address 172.67.72.193.
Q: In what country are Avsim.su servers located in?
A: Avsim.su has servers located in the United States.
Q: What webserver software does Avsim.su use?
A: Avsim.su is powered by CloudFlare webserver.
Q: Who hosts Avsim.su?
A: Avsim.su is hosted by T-Mobile USA, Inc. in United States.
Q: How much is Avsim.su worth?
A: Avsim.su has an estimated worth of $73,200. An average daily income of approximately $122, which is roughly $3,711 per month.

Avsim.su Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Avsim.su Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Avsim.su

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

16 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-7657732-1

Links - Internal

105:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Avsim.su

5 boeingairbusfunctionairlines5rarr mfs2020quotboeingtrues3mfs2020 5s7rarr fs2004 5quotquotfs20040rarr fs2004a320s7 airlinesvar2rmsmillerrarr mfs2020 51 minusfrarr41nbsprarrupdatepopvideosizerarr flyin vatsimfs2004 5newwidthflyin vatsimmfs2020rarr 5minushttpsminus 1minus 1 minusrarr flyinxplaneflyinvatsim

Who hosts Avsim.su?

Avsim.su Hosting Provider Information

Hosted IP Address:172.67.72.193
Hosted Hostname:172.67.72.193
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
T-Mobile USA, Inc.
1.2248%

HTTP Header Analysis for Avsim.su

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 27 Nov 2020 15:00:02 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Access-Control-Allow-Origin: *
Cache-Control: no-cache, private
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Pragma: no-cache
CF-Cache-Status: DYNAMIC
cf-request-id: 06abd0f88e0000075a62ba5000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=sItIlQFUOc1aRY5owXLd2E1cNYFIXGM1LBx6OPKcOSJQCQyeRAZPSIKgrOAFqth44jovZNcDlQAN4ZAaXX59jsm8xjZJQm421KPtUug="}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5f8cb76da8ec075a-LHR
Content-Encoding: gzip

Avsim.su Domain Nameserver Information

HostIP AddressCountry
norm.ns.cloudflare.com 173.245.59.134
roxy.ns.cloudflare.com 173.245.58.142


Need to find out who hosts Avsim.su?


Domain Registration (WhoIs) information for Avsim.su

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: AVSIM.SU
descr: E-mail address listed here delivers only messages from NIC.ru. For administrative contact visit:
descr: http://www.avsim.su/contact.phtml
descr: Submit the form and we will get back to you shortly.
nserver: norm.ns.cloudflare.com.
nserver: roxy.ns.cloudflare.com.
state: REGISTERED, DELEGATED
person: Private Person
e-mail: Login to show email
RUCENTER-SU
created: 2008-05-25T20:00:00Z
paid-till: 2021-05-25T21:00:00Z
free-date: 2021-06-28
source: TCI

Last updated on 2020-11-27T14:56:30Z

Websites with Similar Names

Avsim.com
AVSIM - The AVSIM Community
Avsim.com.ar
Avsim - Obra Social para Mascotas
Avsim.net
AVSIM - The AVSIM Community
Avsim.su
[28.11.20] 11-14z Practical exam UUWV_CTR. - Avsim.su
Avsima.com
avsima.com | Ücretsiz yapım aşamasında sayfası
Avsima.xyz
avsima.xyz | Ücretsiz yapım aşamasında sayfası
Avsimmigration.in
HOME - Avs Immigration
Avsimplicity.com
Error 404 (Not Found)!!1

Recently Updated Websites

Hotwheelscartel.com (2 seconds ago.)Wscsites.com (3 seconds ago.)Villaagung.club (4 seconds ago.)Mysbvvault.com (6 seconds ago.)Natuza-events.com (6 seconds ago.)Coppertreebeer.com (7 seconds ago.)Spardhaindia.org (9 seconds ago.)Domuslloguers.cat (9 seconds ago.)Livelovehoustontexas.com (10 seconds ago.)Vulneras.com (10 seconds ago.)Redington.biz (11 seconds ago.)Innovationinlanguage.com (12 seconds ago.)Bodeefitness.com (13 seconds ago.)Cryptotub.com (15 seconds ago.)Craftyourgear.com (15 seconds ago.)Orthomol.live (18 seconds ago.)Watt37srl.com (24 seconds ago.)Reducingcremationcosts.com (25 seconds ago.)Davidlin5688.com (27 seconds ago.)Litterpaw.info (27 seconds ago.)Ldian8.com (29 seconds ago.)Neomexports.com (32 seconds ago.)Hepsibirpro.com (34 seconds ago.)Breakwaterapts.com (36 seconds ago.)Thomasflintcopy.com (37 seconds ago.)Alchemytw.com (38 seconds ago.)Imud.co.il (38 seconds ago.)Zielonyslon.com (38 seconds ago.)Amigosdekanu.com (38 seconds ago.)Meinegier.com (40 seconds ago.)

Recently Searched Keywords

united statespublictitle30inches (1 second ago.)viruses amp (13 seconds ago.)objectrequestin (13 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (19 seconds ago.)неестественно (19 seconds ago.)lal kitab upay for husband (21 seconds ago.)icollector admin login (26 seconds ago.)1 sv (28 seconds ago.)skandal (37 seconds ago.)nomad street kid corpo (47 seconds ago.)carousel-75 rpc-content (54 seconds ago.)active 4 lessons (56 seconds ago.)ahover (57 seconds ago.)cmds to see (57 seconds ago.)st dunstans (57 seconds ago.)preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle (1 minute 1 second ago.)vu cua (1 minute 1 second ago.)vng cc n (1 minute 4 seconds ago.)hitogel 45 (1 minute 5 seconds ago.)colorantes para jabones (1 minute 5 seconds ago.)b7 oil gmbh (1 minute 5 seconds ago.)1 if (1 minute 6 seconds ago.)vng cc (1 minute 6 seconds ago.)vng c nhiu (1 minute 8 seconds ago.)vng c (1 minute 10 seconds ago.)vn n (1 minute 12 seconds ago.)vn chuyn nhanh (1 minute 14 seconds ago.)vn chuyn hng (1 minute 17 seconds ago.)con motore (1 minute 18 seconds ago.)vn chuyn d (1 minute 19 seconds ago.)