Azure Container Registry | Microsoft Azure

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 360,918
Estimated Worth: $24,840
Category: This site has not been categorized yet

Azurecr.io is a subdomain of Io

Store images for all types of container deployments and OCI artifacts, using Azure Container Registry.



Domain summary

Last updated
2021-06-07
Domain label
azurecr
Domain extension
io
Global Traffic Rank
360,918
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$24,840
Estimated daily income
$46
Estimated monthly income
$1,399

Frequently Asked Questions (FAQ)

Q: When was Azurecr.io registered?
A: Azurecr.io was registered 5 months, 3 weeks, 4 days, 6 hours, 35 minutes, 7 seconds ago on Monday, June 7, 2021.
Q: When was the WHOIS for Azurecr.io last updated?
A: The WHOIS entry was last updated 5 months, 3 weeks, 4 days, 6 hours, 35 minutes, 7 seconds ago on Monday, June 7, 2021.
Q: What are Azurecr.io's nameservers?
A: DNS for Azurecr.io is provided by the following nameservers:
  • ns2-01.azure-dns.net
  • ns1-01.azure-dns.com
  • ns4-01.azure-dns.info
  • ns3-01.azure-dns.org
Q: Who is the registrar for the Azurecr.io domain?
A: The domain has been registered at .
Q: What is the traffic rank for Azurecr.io?
A: Azurecr.io ranks 360,918 globally on Alexa. Azurecr.io has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Azurecr.io each day?
A: Azurecr.io receives approximately 4,133 visitors and 16,532 page impressions per day.
Q: What IP address does Azurecr.io resolve to?
A: Azurecr.io resolves to the IPv4 address 40.112.72.205.
Q: In what country are Azurecr.io servers located in?
A: Azurecr.io has servers located in the Ireland.
Q: What webserver software does Azurecr.io use?
A: Azurecr.io is powered by webserver.
Q: Who hosts Azurecr.io?
A: Azurecr.io is hosted by MICROSOFT-CORP-MSN-AS-BLOCK in Leinster, Dublin, Ireland, D02.
Q: How much is Azurecr.io worth?
A: Azurecr.io has an estimated worth of $24,840. An average daily income of approximately $46, which is roughly $1,399 per month.

Azurecr.io Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Azurecr.io Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Azurecr.io

H1 Headings

1 :
  1. Container Registry

H2 Headings

14 :
  1. Simplify container lifecycle management
  2. Store your container images and beyond
  3. Utilize pipelines for development and patching
  4. Scale globally with a few clicks
  5. Put private images on a private network
  6. Help safeguard content delivery with Content Trust
  7. Check images with Azure Security Center integration
  8. Why trust Azure Container Registry?
  9. Flexible pricing keeps you in control
  10. Get started today
  11. Developer resources
  12. Trusted by companies of all sizes
  13. Frequently asked questions about Azure Container Registry
  14. Ready when you are—let’s set up your Azure free account

H3 Headings

5 :
  1. Microsoft invests more than 1 billion USD annually on cybersecurity research and development.
  2. We employ more than 3,500 security experts focused on your data security and privacy.
  3. Azure has more certifications than any other cloud provider. View the comprehensive list.
  4. Documentation
  5. Microsoft Learn

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

19 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Outbound

285:

Links - Outbound (nofollow)

0:

Keyword Cloud for Azurecr.io

modelacrossgetdigitalsee more seebusinesscognitive servicesdeploy highqualityazure sqlmanagedyoursqlmanaged always uptodateapplications usingdesktop experience deliveredrunappsazure costakssimplify the deploymenttypelistitem positionvarazure sqlmanaged alwaysget startedapp servicequickly createlearningmore seeonlystoryaccountvaluekubernetes service akssimplifybuildingaicontentpushusedsecurityactive directorysynchronizedevelopers partnersyour cloud spendingkubernetes serviceupserverless codefalseintelligentcognitive servicesdeploysaleshelp protectsqlmanaged alwaysartifactsapplicationsactive directorysynchronize onpremisesapp servicequicklykrazure functionsprocessdatabase migrationcontrolmobile azurefunctionsprocess eventsnamecloudnativeapis for anyfreeserverlesssecuredirectorysynchronize onpremises directoriescontainerai modelsenablecloud appsnewsearch servicerunningcloud search servicecontainer registrydollardomainelsecontainer imagesdbfast nosqlprivate networkhybrid cloudazure blobcosmosbuilddevelopertestingreliable contentalways uptodate sqlsee moremachinevirtual desktophelp protect youryour applicationsdevopsnetworkoci artifactsazure activestoragemassively scalableopen apistestmicrosoft azureazure cognitiveconnectivitysharevisual studiomanagementpublish apisservicesdeploy highquality aisingleregistryazure databasecostsenuseasyjquery function globaltoolsnextgenerationoperations of kubernetesreadcontent trustopenallazure kubernetesdirectorysynchronizecomputeemployeessiliconyour azuretimehighquality aischedulingstudiodatabase with openazure cosmossqlmanagedcreatepowerful cloudsupportserviceazure active directorysynchronizebroad globaleventskubernetesdeploywindows virtualsecurelywindows and linuxnetworkensureusethanstorageazure iotcognitive searchaipoweredcosmos dbfastmarketplacedevicesservicequicklyvmwarebestcloudprivateapismodels as apisazure azurecommunitysearchaipowered cloud searchpricingotherusersenterpriseenable single signonprotectiondesktopfunctionhighqualitystoredevelopersapp development azureprotectinfrastructureazure functionsprocess eventspatchingnosql databasewindows virtual desktopappdirectories and enableazure active directoryyour cloudglobaltasksdockerenglishazure virtualmoregovernancenetworkensure secure reliablepositionimagesdeliverydevelopmentservice azuremediaanycreate powerfulweb app developmentanywherelinuxsecure reliable contentstartedmixed0nosqlsqlassetscontent delivery networkensurecloud azureunifiedcostplatformcontent deliverycollaborativeiot solutionsfree accountdonefunctiondelivered on azureapis to developersactive directoryservicequickly create powerfulquestionstrustintelligenceany scalered hatsql instanceevents with serverlessocirscale azureany platformaccount portalsearchaipowered cloudreliableglobal reachreliable content deliverymanagedeployment managementdeploymentworkmanagededgeimagedidinitwithoutseeavailablemobile and webblobapi managementpublishiothatwindowlpinitializestartthreatsyour businesscustomersidentitysql serveradvancedoperationsmanagementuscodeuptodate sqlservicequickly createazure cognitive searchaipoweredenabledsubmitinputsattrdisabledintegrationstreamrealtimeakssimplifysazure kubernetes servicefastenvironmentscompliancedocumentationlearnworkloadsuptodateinitmunchkinhelphighquality ai modelswindowcontextpartners and employeesexperience deliveredactivebroad global reachcosmos dbfast nosqlbest virtualweb applistitemapi managementpublish apishybrid cloud workloadsdirectoriesstoragemassivelyblockchainpowerfulmodelsfullydelivery with broaduptodate sql instanceworkloads azurespendingservicesdeploy highqualityalways uptodatewindowonloadscalabletrustedstatusteamsreal timeconfidencemonitorfastermanagingazure cosmos dbfastdeliveredphysicaldbfastddosfindsolutiontracksignbuiltinartifactdelivery networkensure secureemployees securelyvirtual desktop experienceprotect yoursecure reliablecode azureservicessoftwareusingprotect againstdiscoverenable singledbfast nosql databasefunctionsprocesslakeprotect your enterprisefunction globalprivacymachinesazureeventwindowonload functionmobilemultiplesignonrealservicesdeployonpremisesanalytics platformagainstcognitive searchaipowered cloudsimplifymanagementpublishincludingtype listitemapp developmentportalsolutionsapiazure datatype listitem positionanalyticsdatabasecognitivemigrationdevelopment azureconnectifdatadeveloper toolscloud searchtextstatusweb applicationsteamdeliverbuiltyoufully managedonpremises directoriesserverazure container registryexperiencesearchreachbest virtual desktopserverless code azurealwaysdelivery networkensureapps for webmixed realityresourcesredmicrosoftdirectoryazure productspowerful cloud appsmanagement and operationsmore see morewebautomatesingle signonservice for mobilenetworkensure secureexperiencesexplorebroadshipdata lakeinnovationguidanceprovidedirectorysynchronize onpremisesplatform azuretodaycreate powerful cloudcommunicationvisualhybridwindowsaccessjquery functiontrueyour enterprisedesktopsazure cognitive servicesdeployvirtualsearchaipoweredusesrealityvirtual machinesbuild testproductsdesktop experienceazure containercloud workloadsjquerycloud spendingservice akssimplifypartnersread the storycontainersweb and mobilescaleinstanceintegratedmachine learning

Longtail Keyword Density for Azurecr.io

KeywordsOccurences
azure container registry16
see more see9
more see more8
azure kubernetes service5
always up-to-date sql4
up-to-date sql instance4
azure active directory4
windows virtual desktop4
app development azure3
web app development3
mobile and web3
help protect your3
protect your enterprise3
azure active directorysynchronize3
active directorysynchronize on-premises3
directorysynchronize on-premises directories3
directories and enable3
enable single sign-on3
windows and linux3
partners and employees3
api managementpublish apis3
apis to developers3
cloud search service3
your cloud spending3
content delivery networkensure3
delivery networkensure secure3
networkensure secure reliable3
secure reliable content3
reliable content delivery3
delivery with broad3
broad global reach3
hybrid cloud workloads3
type listitem position3
read the story3
service for mobile3
cognitive searchai-powered cloud3
searchai-powered cloud search3
dbfast nosql database3
virtual desktop experience3
desktop experience delivered3
delivered on azure3
azure sqlmanaged always3
sqlmanaged always up-to-date3
app servicequickly create3
servicequickly create powerful3
create powerful cloud3
powerful cloud apps3
apps for web3
web and mobile3
azure cosmos dbfast3
cosmos dbfast nosql3
database with open3
best virtual desktop3
apis for any3
kubernetes service akssimplify3
akssimplify the deployment3
management and operations3
operations of kubernetes3
azure functionsprocess events3
events with serverless3
serverless code azure3
azure cognitive servicesdeploy3
cognitive servicesdeploy high-quality3
servicesdeploy high-quality ai3
high-quality ai models3
models as apis3
azure cognitive searchai-powered3
jquery function global3
see more31
container registry22
azure container16
cloud azure10
more see9
container images8
windows virtual7
content delivery7
virtual desktop7
azure active7
azure cognitive6
protect your6
azure iot6
workloads azure5
visual studio5
azure database5
azure kubernetes5
azure data5
web app5
your cloud5
function global5
kubernetes service5
windowonload function5
azure azure5
free account5
virtual machines5
your enterprise4
sql server4
sql instance4
your business4
scale azure4
up-to-date sql4
database migration4
always up-to-date4
jquery function4
private network4
data lake4
active directory4
microsoft azure4
mixed reality4
hybrid cloud4
get started4
content trust4
your azure4
your applications4
machine learning4
code azure4
web applications3
cloud spending3
azure cost3
deployment management3
desktop experience3
real time3
iot solutions3
platform azure3
best virtual3
developers partners3
managementpublish apis3
api managementpublish3
azure virtual3
azure functionsprocess3
protect against3
employees securely3
networkensure secure3
delivery networkensure3
type listitem3
nosql database3
azure products3
open apis3
any scale3
oci artifacts3
listitem position3
azure cosmos3
single sign-on3
cloud workloads3
mobile azure3
service akssimplify3
global reach3
broad global3
reliable content3
secure reliable3
experience delivered3
on-premises directories3
enable single3
service azure3
fully managed3
account portal3
app servicequickly3
azure blob3
storagemassively scalable3
analytics platform3
servicequickly create3
powerful cloud3
development azure3
app development3
create powerful3
search service3
cloud search3
searchai-powered cloud3
applications using3
ai models3
cognitive searchai-powered3
sqlmanaged always3
directorysynchronize on-premises3
active directorysynchronize3
functionsprocess events3
serverless code3
azure sqlmanaged3
help protect3
cloud apps3
red hat3
developer tools3
dbfast nosql3
any platform3
build test3
cognitive servicesdeploy3
servicesdeploy high-quality3
high-quality ai3
cosmos dbfast3
azure202
cloud53
your51
container39
more39
see37
data33
registry31
service27
function27
virtual24
content21
web21
scale20
apps20
images19
security19
secure17
true17
applications16
any16
build15
support14
mobile14
app14
across14
windows14
analytics14
management14
if14
iot13
managed13
manage13
free12
platform12
database12
development12
var11
sql11
scalable11
apis11
microsoft11
global10
private10
using10
delivery10
account10
on-premises10
code10
network9
services9
protect9
enable9
all9
dollar9
create9
storage9
tools9
desktop9
best9
enterprise8
get8
use8
false8
resources8
you8
solutions8
ai8
migration8
products8
building8
oci8
kubernetes8
blockchain7
hybrid7
image7
business7
devices7
event7
artifacts7
powerful7
edge7
deploy7
machine7
active7
developer7
docker7
access7
documentation7
pricing7
tasks7
workloads7
single7
server6
jquery6
instance6
intelligent6
containers6
search6
up6
cognitive6
devops6
time6
models6
learning6
visual6
environments6
integration6
work5
teams5
privacy5
community5
studio5
learn5
anywhere5
experiences5
english5
start5
run5
help5
connect5
trust5
window5
cost5
infrastructure5
en-us5
windowonload5
machines5
linux5
intelligence5
integrated5
high-quality5
governance5
events5
started4
patching4
easy4
value4
other4
monitor4
real4
serverless4
mixed4
deployment4
operations4
automate4
portal4
ddos4
available4
open4
identity4
type4
advanced4
directory4
domain4
read4
partners4
experience4
always4
status4
us4
reality4
scheduling4
compute4
faster4
without4
up-to-date4
built4
04
position4
media4
team4
lake4
provide4
communication4
test4
trusted4
deliver4
store4
new4
reliable4
simplify4
control3
costs3
used3
sqlmanaged3
desktops3
solution3
context3
customers3
push3
delivered3
users3
vmware3
marketplace3
else3
initmunchkin3
didinit3
s3
kr3
enabledsubmitinputsattrdisabled3
donefunction3
windowlpinitialize3
story3
uses3
than3
questions3
only3
sales3
artifact3
multiple3
sign3
find3
name3
listitem3
explore3
including3
model3
guidance3
track3
functionsprocess3
cloud-native3
servicesdeploy3
today3
collaborative3
searchai-powered3
testing3
confidence3
silicon3
software3
ship3
share3
directorysynchronize3
unified3
innovation3
r3
stream3
fast3
storagemassively3
hat3
red3
blob3
managing3
fully3
akssimplify3
directories3
reach3
next-generation3
broad3
networkensure3
built-in3
running3
spending3
servicequickly3
protection3
cosmos3
compliance3
connectivity3
physical3
digital3
sign-on3
discover3
assets3
dbfast3
real-time3
securely3
employees3
developers3
managementpublish3
api3
threats3
against3
nosql3
textstatus3

Who hosts Azurecr.io?

Azurecr.io Hosting Provider Information

Hosted IP Address:40.112.72.205
Hosted Hostname:40.112.72.205
Service Provider:MICROSOFT-CORP-MSN-AS-BLOCK
Hosted Country:IrelandIE
Location Latitude:53.3382
Location Longitude:-6.2591
Webserver Software:Not Applicable

Is "MICROSOFT-CORP-MSN-AS-BLOCK" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
MICROSOFT-CORP-MSN-AS-BLOCK
0.1344%

HTTP Header Analysis for Azurecr.io

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Keep-Alive: timeout=10, max=100
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Azure-Version: 20210604-1030-249492
Azure-SiteName: acom-prod-uksouth-02
Azure-InstanceId: 491428410516d0f93c72bbdf41f24190a8b5ded2b2e5c7d37a7622d253691003
Azure-RegionName: UK South
Azure-SlotName: production
Request-Context: appId=cid-v1:271db03b-0de6-4bf7-8ebf-f90dccf4de6b
Access-Control-Expose-Headers: Request-Context
X-Content-Type-Options: nosniff
X-Frame-Options: sameorigin
Arr-Disable-Session-Affinity: true
Access-Control-Allow-Methods: GET,HEAD
Strict-Transport-Security: max-age=31536000
X-Cache: CONFIG_NOCACHE
X-MSEdge-Ref: Ref A: BD7708E33C1B473F9373AC34DB9EF840 Ref B: LON04EDGE1016 Ref C: 2021-06-07T09:00:23Z
Date: Mon, 07 Jun 2021 09:00:22 GMT

Azurecr.io Domain Nameserver Information

HostIP AddressCountry
ns2-01.azure-dns.net 64.4.48.1
ns1-01.azure-dns.com 40.90.4.1
ns4-01.azure-dns.info 13.107.160.1
ns3-01.azure-dns.org 13.107.24.1


Need to find out who hosts Azurecr.io?


Domain Registration (WhoIs) information for Azurecr.io

 Domain Name: AZURECR.IO
Registry Domain ID: D503300000040548444-LRMS
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: http://www.markmonitor.com
Updated Date: 2020-06-18T19:26:09Z
Creation Date: 2016-07-26T22:45:32Z
Registry Expiry Date: 2021-07-26T22:45:32Z
Registrar Registration Expiration Date:
Registrar: MarkMonitor Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2083895740
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Microsoft Corporation
Registrant State/Province: WA
Registrant Country: US
Name Server: NS4-01.AZURE-DNS.INFO
Name Server: NS2-01.AZURE-DNS.NET
Name Server: NS1-01.AZURE-DNS.COM
Name Server: NS3-01.AZURE-DNS.ORG
DNSSEC: unsigned

>>> Last update of WHOIS database: 2021-06-07T08:59:23Z

Websites with Similar Names

Azure-academy.org
Azure Academy
Azure-admin.no
azure-admin.no is parked
Azure-adventures.com
Azure Adventures
Azure-aeromed.com
Aeromedical Landing Page - Azure Aeromedical
Azure-affiliates.com
Home - Azure Affiliates
Azure-angel.net
DOMAIN ERROR

Recently Updated Websites

Acnhshop.net (8 seconds ago.)Thingxr.com (15 seconds ago.)The-cat-paradise.com (21 seconds ago.)Sharpstandard.com (23 seconds ago.)Uooge.com (27 seconds ago.)18grandecasse.com (30 seconds ago.)Captainwallet.com (33 seconds ago.)Club.equipment (34 seconds ago.)Muncieendurathon.com (35 seconds ago.)Needbasedbusiness.com (36 seconds ago.)Heirloomengraversworldwide.com (41 seconds ago.)Winfred.com (41 seconds ago.)Innov8ux.com (43 seconds ago.)Donwhiteok.com (46 seconds ago.)Seedhibaat.com (49 seconds ago.)Ldconstructionnc.com (52 seconds ago.)Iceewatter.com (54 seconds ago.)Woodxwood.com (55 seconds ago.)Total-teacher.com (55 seconds ago.)Aoa4791.vip (57 seconds ago.)Digitbizz.com (1 minute ago.)Safetypois.space (1 minute ago.)Henryneeds.coffee (1 minute ago.)Ar-skewell.com (1 minute 7 seconds ago.)Valentines-aquajetcleaning.com (1 minute 8 seconds ago.)Teslalethbridge.com (1 minute 9 seconds ago.)Alexwebmaster.com (1 minute 15 seconds ago.)Wrightgenesis.com (1 minute 16 seconds ago.)Cdwyzz.com (1 minute 17 seconds ago.)Addictivemarketing.com (1 minute 18 seconds ago.)

Recently Searched Keywords

domus (2 seconds ago.)ka maseeha (2 seconds ago.)chroniques club 2007 (2 seconds ago.)lonworks (3 seconds ago.)петушинская районная больница (4 seconds ago.)biome-mimicry (4 seconds ago.)porndoe (4 seconds ago.)jbtmetal.com (5 seconds ago.)casemod (6 seconds ago.)квартирний облік (6 seconds ago.)بهداشت مادر کودک (7 seconds ago.)email icon (7 seconds ago.)полномочия омс (7 seconds ago.)my qiagen (7 seconds ago.)d6n (8 seconds ago.)about ataxia-telangiectasia (8 seconds ago.)s2egnddata-placements3722gsvjay4opacity0transitiontransform (8 seconds ago.)работникам бюджетной сферы (8 seconds ago.)20pxmarathon (8 seconds ago.)nbsp 3010 (9 seconds ago.)паспорт района (10 seconds ago.)click here to view all activities magnifying glass view all activities (10 seconds ago.)teste de velocidade (12 seconds ago.)hidro solo (15 seconds ago.)сведения о руководителях (16 seconds ago.)kahoot it (17 seconds ago.)ответственность за коррупционные нарушения (17 seconds ago.)corporate domains (18 seconds ago.)cornelia grimsmo height (18 seconds ago.)微博最新流出高贵气质极品美少妇激情自拍视频 (18 seconds ago.)