|  Mein Baby | Alle Infos rund ums Baby -
Low trust score  | 
BABYCLUB.DE – Dein Portal für Kinderwunsch, Schwangerschaft und Babyzeit. Hebammensprechstunde, Vornamen, Community, Schwangerschaftskalender und vieles mehr. Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:162,010
Majestic Rank Majestic Rank:446,997
Domain Authority Domain Authority:51%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:

Status: connect
Changed: 2010-07-28T18:37:12+02:00

Type: ROLE
Name: Hostmaster
Address: Alfons-Feifel-Str. 9
PostalCode: 73037
City: Goeppingen
CountryCode: DE
Phone: +49 7161 93339-0
Fax: +49 7161 93339-99
Email: Login to show email

Type: ROLE
Name: Hostmaster
Address: Alfons-Feifel-Str. 9
PostalCode: 73037
City: Goeppingen
CountryCode: DE
Phone: +49 7161 93339-0
Fax: +49 7161 93339-99
Email: Login to show email

Who hosts is hosted by imos GmbH in Baden-wurttemberg, Goppingen, Germany, 73037. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service Provider:imos GmbH
Hosted Country:GermanyDE
Location Latitude:48.7028
Location Longitude:9.65488
Webserver Software:unknown
Google Map of 50,12

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Date: Mon, 20 Jul 2015 10:50:42 GMT

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

babys erstesderdaswerdenelse documentwritennn ifmitelseifimfunctionalles berampschwangerschaftsgymnastiksiebabyclubde newsberechnenschwangerschaftskalenderspermienqualittn nschwangerschaftsterminbersichtschwangerschaftafrikababyeuchallesaufbeantwortet von unsereristjahrdurchzeitbabyhoroskopeventunsererbodymit demmutterschutzgesetzihrzumerstesdocumentwritennn ifsswbeliebteif sitemobile documentwritennnesschwangerschaftsgymnastikappmein babywirkostenlosvonjungennamenkanneinelse documentwritennngutschriftgeburtauchmamafotogalerienbabyclubdezur geburtlebenjetztbestedemhatbmirechneralleeineber0himbeerbltterteeundefinedkindrundif sitemobile documentwritebabyschlafoderbabyclubtvstillenn n nnewshebammenhebammekinderwunschappvarzumdchennamenmehr babyclubdesourcebabysfrvon unserer hebammeunserer hebammezurkinderwunsch1unserejungediebeidocumentwritennn elsehellipforenalsbeantwortet vonbeantworteteinenihrevornamenbeimtopdeninfosrund umsitemobile documentwritennn elsesitemobile documentwritemuttermilchdocumentwritennnfindendocumentwrite elsenumnochhibbellistediesesitemobileif sitemobilemeinwirdfrageunsdocumentwritenichttippsfamilienbismehrdocumentwritennn if sitemobilesitemobile documentwritennndocumentwritennn else documentwritennnvon unserertriodoshier

Longtail Keyword Density for

if sitemobile documentwrite4
von unserer hebamme4
beantwortet von unserer4
else documentwritennn if3
documentwritennn if sitemobile3
documentwritennn else documentwritennn3
if sitemobile documentwritennn3
n n n3
sitemobile documentwritennn else3
if sitemobile7
n n6
else documentwritennn5
unserer hebamme4
von unserer4
beantwortet von4
babyclubde news4
rund um4
sitemobile documentwrite4
mein baby4
documentwritennn else3
sitemobile documentwritennn3
documentwrite else3
documentwritennn if3
zur geburt3
babys erstes3
mit dem3
alles ber3
mehr babyclubde3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Germany Germany DNS Record Analysis DNS Lookup

Serial: 2011111403
Refresh: 600
Retry: 5400
Expire: 900000
babyclub.deMX86400Priority: 20

Alexa Traffic Rank for

Alexa Search Engine Traffic for