Babyclub.de Website Analysis Summary

Babyclub.de  |  BABYCLUB.DE – Dein Portal für Kinderwunsch, Schwangerschaft und Babyzeit. Hebammensprechstunde, Vornamen, Community, Schwangerschaftskalender und vieles mehr.
Low trust score  | 
Mein Baby | Alle Infos rund ums Baby - babyclub.de


Rank
397,777
Rating
G
Trust Score
Low Trust Score
Estimated worth
$23,220
Estimated daily income
$43
Estimated monthly income
$1,308
Backlinks
0

Babyclub.de has a Low Trust Score, and a Statvoo Rank of G.

Babyclub.de is hosted by imos GmbH in Baden-wurttemberg, Goppingen, Germany, 73037.
Babyclub.de has an IP Address of 212.87.146.225 and a hostname of babyclub-lighty-live.imos.net.

The domain babyclub.de was registered 201 decades 9 years 4 months ago by , it was last modified 1 decade 6 years 10 months ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 397,777 most popular site among over 300 million websites.

Babyclub.de has a total of 0 backlinks.

Babyclub.de gets approximately 3,872 unique visitors a day and 15,488 pageviews per day.

Babyclub.de has an estimated worth of $23,220.
An average daily income of approximately $43, which is wroughly $1,308 per month.

Whois information for babyclub.de

Full Whois Lookup for Babyclub.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: babyclub.de
Nserver: ns1.imos.net
Nserver: ns2.imos.net
Status: connect
Changed: 2010-07-28T18:37:12+02:00

[Tech-C]
Type: ROLE
Name: Hostmaster
Address: Alfons-Feifel-Str. 9
PostalCode: 73037
City: Goeppingen
CountryCode: DE
Phone: +49 7161 93339-0
Fax: +49 7161 93339-99
Email: Login to show email
2003-03-18T13:59:29+01:00

[Zone-C]
Type: ROLE
Name: Hostmaster
Address: Alfons-Feifel-Str. 9
PostalCode: 73037
City: Goeppingen
CountryCode: DE
Phone: +49 7161 93339-0
Fax: +49 7161 93339-99
Email: Login to show email
2003-03-18T13:59:29+01:00

Who hosts Babyclub.de?

Babyclub.de Web Server Information

Hosted IP Address:212.87.146.225
Hosted Hostname:babyclub-lighty-live.imos.net
Service Provider:imos GmbH
Hosted Country:GermanyDE
Location Latitude:48.7028
Location Longitude:9.65488
Webserver Software:unknown

HTTP Header Analysis for Babyclub.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Date: Mon, 20 Jul 2015 10:50:42 GMT

Need to find out who hosts Babyclub.de?

Babyclub.de Free SEO Report

Website Inpage Analysis for Babyclub.de

H1 Headings:1
babyclub.de - alle Infos rund um meine Schwangerschaft & mein Baby
H2 Headings:10
Für neue Mitglieder im Holle Babyclub:
Gesetzesänderung 2020
Special: Yoga mit Baby
Was tun bei Atemstillstand?
Top Namen
Hebammen-Kurssuche
Willkommen bei babyclub.de
Meistgeklickt im babyclub:
Baby-News bei babyclub.de:
Infos rund um mein Baby auf einen Klick!
H3 Headings:6
10€ Rabatt auf deine Bestellung im Holle Onlineshop
Das ändert sich 2020 für Familien
20 Minuten Yoga für Mama und Kind!
Herzdruckmassage beim Baby
Jetzt den Richtigen finden
Finde Hebammenkurse in deiner Nähe
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:3
Total Images:100
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Babyclub.de

mehralleszur geburtmdchennamenaufmamafrnochelseeventtopistvon unserer hebammefindenn n nhebammenichtunsererumfunctionunserer hebammesitemobile documentwritennn elseschwangerschaftskalenderafrikababyhoroskopfotogaleriensourceberundefinedeinbabysdocumentwritennn ifnhierfamilienvardassiebabyclubde newsdemstillenwerdendocumentwritennnhibbellistediedocumentwritekinderwunscheineerstesinfoskannoderschwangerschaftsterminbersichtkostenlosschwangerschaftsgymnastikappmitif sitemobile documentwritealseshatnewsmuttermilchberechnenrund umsitemobile documentwritennnimtippsihrebeliebtesswhebammenjahrmit demunszurkindhimbeerbltterteebeim1schwangerschaftzualles berwirddocumentwritennn else documentwritennndocumentwritennn if sitemobilebeantwortet vonsitemobile documentwritespermienqualittdereuchdurchhellipif sitemobile documentwritennnbestebabyclubdeihrzumbabyjetztbisgeburtmeinmehr babyclubdebeantwortet von unsererjungeif sitemobileeinendensitemobilediesebmirechnermein babyelse documentwritennn ifn njungennamengutschriftvornamendocumentwrite elseelse documentwritennnvonbabyclubtvdocumentwritennn elsebodyunserealleauchbabyschlafforenrundleben0fragemutterschutzgesetztriodoskinderwunschappifbabys ersteszeitbeantwortetampschwangerschaftsgymnastikvon unsererbeiwir

Longtail Keyword Density for Babyclub.de

KeywordsOccurences
if sitemobile documentwrite4
von unserer hebamme4
beantwortet von unserer4
else documentwritennn if3
documentwritennn if sitemobile3
documentwritennn else documentwritennn3
if sitemobile documentwritennn3
n n n3
sitemobile documentwritennn else3
if sitemobile7
n n6
else documentwritennn5
unserer hebamme4
von unserer4
beantwortet von4
babyclubde news4
rund um4
sitemobile documentwrite4
mein baby4
documentwritennn else3
sitemobile documentwritennn3
documentwrite else3
documentwritennn if3
zur geburt3
babys erstes3
mit dem3
alles ber3
mehr babyclubde3
fr21
mit16
babyclubde15
if14
die14
mehr13
das12
n12
baby11
von11
schwangerschaft11
babys10
ein10
jetzt10
der9
stillen8
wir8
eine8
zum8
else8
documentwritennn8
geburt8
zu8
oder7
ist7
vornamen7
sitemobile7
werden7
documentwrite7
ssw6
alles6
ber6
sie6
den6
hebammen5
auf5
es5
zur5
bei5
rund5
einen5
hebamme5
infos5
im5
um5
hier5
body5
var5
beste4
amp4
leben4
bis4
beantwortet4
babyclubtv4
kinderwunsch-app4
hellip4
babyhoroskop4
gutschrift4
unsere4
dem4
finden4
source4
unserer4
hibbelliste4
mein4
news4
beim4
kinderwunsch4
kind4
himbeerblttertee4
mama4
jahr4
auch4
mdchennamen3
jungennamen3
schwangerschaftsterminbersicht3
frage3
kostenlos3
bmi-rechner3
schwangerschaftskalender3
top3
undefined3
foren3
function3
schwangerschaftsgymnastik-app3
fotogalerien3
event3
03
beliebte3
junge3
uns3
hat3
euch3
diese3
tipps3
erstes3
durch3
muttermilch3
als3
schwangerschaftsgymnastik3
kann3
noch3
spermienqualitt3
nicht3
alle3
berechnen3
afrika3
triodos3
13
ihr3
wird3
babyschlaf3
zeit3
familien3
mutterschutzgesetz3
ihre3

What are the nameservers for babyclub.de?

Babyclub.de Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown