BabySam.dk - Alt til baby & børn - Babysam.dk

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 780,382
Estimated Worth: $1,440
Last updated:2020-10-09
Category: Shopping > Children

BabySam er Danmarks største kæde for babyudstyr, børnetøj og alt til dig som er gravid. Køb online eller i en af vores mange fysiske butikker


Domain summary

Domain label
babysam
Domain extension
dk
Global Traffic Rank
780,382
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,440
Estimated daily income
$6
Estimated monthly income
$183

Rank summary

How is babysam.dk ranked relative to other sites:

Percentage of visits to babysam.dk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Babysam.dk registered?
A: Babysam.dk was registered 4 months, 3 weeks, 6 days, 22 hours, 14 minutes, 42 seconds ago on Friday, October 9, 2020.
Q: When was the WHOIS for Babysam.dk last updated?
A: The WHOIS entry was last updated 4 months, 3 weeks, 6 days, 22 hours, 14 minutes, 42 seconds ago on Friday, October 9, 2020.
Q: What are Babysam.dk's nameservers?
A: DNS for Babysam.dk is provided by the following nameservers:
  • ns02.athena-hosting.dk
  • ns03.athena-hosting.dk
  • ns01.athena-hosting.dk
Q: Who is the registrar for the Babysam.dk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Babysam.dk?
A: Babysam.dk ranks 780,382 globally on Alexa. Babysam.dk has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Babysam.dk each day?
A: Babysam.dk receives approximately 910 visitors and 1,820 page impressions per day.
Q: What IP address does Babysam.dk resolve to?
A: Babysam.dk resolves to the IPv4 address 91.215.161.129.
Q: In what country are Babysam.dk servers located in?
A: Babysam.dk has servers located in the Denmark.
Q: What webserver software does Babysam.dk use?
A: Babysam.dk is powered by webserver.
Q: Who hosts Babysam.dk?
A: Babysam.dk is hosted by Athena IT-Group A/S in Central Jutland, Silkeborg, Denmark, 8600.
Q: How much is Babysam.dk worth?
A: Babysam.dk has an estimated worth of $1,440. An average daily income of approximately $6, which is roughly $183 per month.

Babysam.dk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Babysam.dk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Babysam.dk

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

2 :
  1. Weekendtilbud - 25% på næsten alt legetøj
  2. GODE RÅD TIL TERMOTØJ & REGNTØJ

H4 Headings

5 :
  1. Gratis BabyBox startpakke
  2. Brand Spotlight
  3. Book en rådgiver
  4. Guides
  5. BabySam Kundeservice

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

30 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

63:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Babysam.dk

har dudu nskerp tlf 7011personligenyherundereller helt afmeldemuligtog vimherunder terminsdatoen tildittil at tilpassealt til babytilmeldtblevet fjernet fraopret mig somp allevrdideltageampsegment scenterrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringcolorlightgreybgpaddingclassstringhjlpersegment s duhusk at medbringeog du vilterminsdatoen tilcustomerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksverticalspacerblockkontakter diggralt tilbelbpgalevering vildu erbetyderlavthar problemerredigere dine interesseomrderpasswordproblemerdu kontakte oskde for babyudstyrind pkurvvarekan altid redigereafmelde digmscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksimageblocksetilbud fra babysamellerogsderforcustomerframeworkapplication mscorlibvaluestextautostoledit valgte afhentningsstedtil dinlinkdenne emailpassword tilmeget meretlf 7011 3010skal duos hvadtil valgidvivi afsender dinordre erstrste kdecustomerframeworkapplicationtitlebabysamdk alt tilprofilmangeder passer tilcustomerframeworkapplicationtitlebabysamdkforhold tilfritil dig somvia emailmscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksbuttonblockcvrvi afsenderdensombehovp etordre modtager duhvisdu vilcenterrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstring mscorlibcustomerframeworkdomaincommoncssclassbruge dit barnsharemail3vores mangekl 13003010 cvropretstilledeleveringsgebyrvia email ogaf klubmscorlibcustomerframeworkdomaincommoncssclassgyldigacceptereraftaletrack trace nrlink duvalgte afhentningssted nrnyt passwordprferenceom link duerleveret vil dubabysamdkdit valgtedig voresbrnetj og altemail medafhentningdin ordre modtagerkontaktet afvoresdu vil modtageer etet trackprismatchbabyudstyr brnetjfamilieet track tracesms med endeligdine interesseomrder hvordandu bliver kontaktetvenligst ettil baby brnvejmed endeligleveringvenligst dinringe tilkalderdit kbskalringemedlem af klubjeroverensstemmelse babysams politikafhentningsstedcenterrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringcolorlightgreybgpaddingclassstring namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto customerframeworkdomainmscorlibvaluestextautostoleet nyt passwordopret mignr derfordelebabymenmscorlibcustomerframeworkdomaincommoncssclass customerframeworkdomain systemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenterer graviddu bliverleveret til ditmodtage inspirationdin ordre hostidsegmenttil afhentningsprgsml kan duer leveret tiltidspunkt 30timessms babysam vilcustomerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksimageblockblev ikke tilmeldtaf vores mangetilpassekontakte osbringer uddu fropmed fragtmandog andre varerser ud til1beskedklmodtageog fdu handlers du blevvi sendertrackstokkedig og dintil os pder erkassenssomdu harleveringsgebyr vi kontakterikke lngereog klarkantil dit valgtekbvalg afalleredesendestil din graviditetannullerebabyudstyrklikkuner ikkemodtager duhvornr din pakkeer dintlfordrebookingmed at sedubruge ditmedalthvis dueventskontakte dig ellersetehar problemer medgraviditet ellerbliver medlemog altafhentning huskmeget2610 rdovredig efterafkontakterbabysamdkdescriptionbabysammedlemstilbudvil du modtageer danmarks strsteinspiration og tilbudbesked omsom medlemsms medoverensstemmelseansgningcvr nr 31370450customerframeworkdomain mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto customerframeworkdomainpakke er levereteller heltklubtil oshvor dualderdig som ernoglemodtage en smstilbud tilbrnsom medlem afdin graviditetfr duvalgteom babyudstyrs kliksms babysamhvordan vifavoritter plngerehvadblevbdemscorlibvaluesvaluetypecustomerframeworkapplicationproductsmodelssearchableproductmodelvednrleveret vilm kontakte digaccepterer duosmedlemstilbud ogindholdet sdu blevcenterrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringcolorlightgreybgpaddingclassstring namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdtobliver kontaktetvarerheltpersonlige datarddin babys alderprofil pfavoritternogle bestemtedu kontaktes dupolitik ommscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto customerframeworkdomainblivepakke er klarpakke erhvordan vi mindholdetonlinerdgiveremail ognavndergravidbabysams politikstrstedu blev ikkeredigerehandlerbrn babysamdkdescriptionbabysammiginteresseomrder hvordan viblev ikkedin ordresmsrd tildu kancustomerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkapplicationproductsmodelssearchableproductmodelvil sketilhjereleveringsgebyr vibarns personligeherunder terminsdatoender passeros p tlfkan altid3010 cvr nret andet segmentpassermitet forventetfragt tiltagerleveringsdaggravid kb onlinelogget inddu en emailbehandlervenligdu vlgem kontakteog tilbud fratilpasse kommunikationenhverkurven pgademdu sprgsml tilnr 31370450forvejen pdin pakkekunneog fremvisordrertakpmscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkapplicationproductsmodelssearchableproductmodelindtastede vrdiindtastede vrdi erpasser tilopdateretemail erdu handler onlinevrdi erfejllevering tilcustomerframeworkapplication mscorlibvaluestexttilinformeresemail med et6din ordre kanfremvis tilsendte smsnamecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto customerframeworkdomainer klar tiler blevetgravid kbsms med beskedendelig2610 rdovre tlfkontaktethandler onlinebabysamscenterrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringpaddingclassstringsprgsml kanmed endelig tidspunktbemrkklub babysamkb onlineaccepterer du samtidiglink du kancustomerframeworkapplication mscorlibvaluestexttilbehr tildit valg1 26100nr der hjlperbabysog tilbudafhentningssted nrindholdet s klikhar setafsender din ordreendnudanmarks strstesortimentflerehar endnumedlem accepterer dutil digtil butikordre kan du5babyudstyr og andreordre hos babysamtil ditnogle sprgsml kantlf 7011customerframeworkapplicationmailikke tilmeldthverdagekurvenaf voresdissevi hardata herunderbedstvarenhos babysambetalinglegcustomerframeworkdomain systemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenterbrnetj ogmedbringe idvil modtagealtid redigereforventetdin pakke erbestemtemscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdtoforventet leveringsgebyr vifsendtp et andetmodtage inspiration ogder hjlpervlgeom linkoplysningernekb online ellertestandet segment sogvlge etbabysam ombringer ud mellemklubben nrdine interesseomrderbliver kontaktet afprference for noglebabysam om babyudstyrringe til osog fremvis tilsendtevi kontakter diglidtfra babysamleveret tilbabyudstyr brnetj ogrdovreemail og smsafsenderoverensstemmelse babysamstil afhentning huskog andreinspirationandre varertil dig oghoshelt afmeldeoslinktypeinternallinkchildrenmenuitemclassisselectedfalsetypecustomerframeworkdomaincmslinkmenuitembutikannullerettilsendte sms medklubben nr dusprgsml til dinafmeldealtid redigere dinevi m kontaktevores sortiment viaog alt tilforholdhvad dudu samtidigdata herunder terminsdatoencustomerframeworkdomainlevering vil skeind p dindig eller heltmere ombliverbabysam vil brugehusker loggetbrnetjklubbendin bestillingbarnskvitteringtilsendte smser logget indgraviditetudvalgtebliver medlem accepterer7011 3010 cvreller din babysalle 3 17du har problemerindenvil bruge ditvre medlemdit barnskommunikationenbabysams politik omautomatisknr din pakkealle 3kan dunytinden kl 1300dig ogdu modtagesprgsmlpopulrekundeservicekan du kontaktedanmarksblevetafhentningssted nr dinleverestil valg afloggetmester leveretkdekommunikationen tilse hvornr dinet trackingtilpasse kommunikationen tilhvornr dinmskesortiment viaklar tilnr dinhvornrsamtidig at modtagesystemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenter centerrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstringpakkedig efter kbvenligst ditinden for kortdig klubben nrhjlper dig medp tlfefterog klar tilcustomerframeworkapplicationtitlebabysamdk alttrack traceleveringsdag hvordkkpunderbabyudstyr ogbabyboxkravdin graviditet ellerog smsmellemcustomerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblockstextblockvidebrugehjemmeer pcenterrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstring mscorlibcustomerframeworkdomaincommoncssclass customerframeworkdomaintrace nr dersom er graviddit barns personligeterminsdatoenbruger allerededanmarks strste kdemedbringeafsluttefragtmanddin ordre ersystemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenter centerrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstring mscorlibcustomerframeworkdomaincommoncssclassregistreret i forvejenmig som medlemkommervores kundeservicecenterrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringpaddingclassstring namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdtovianr dugraviditet eller dinbabysamdkdescriptionbabysam er danmarksrentefysiskedu etmscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksverticalspacerblockid ogdu alleredehvordanmail medgerneer registreretandettidspunkttil babyvredin babysouterwearsprgsml tilkontakter dig eftertermotjingenvores sortimentalder i overensstemmelseaftale endeliget andetvalgsendermig somvalgte afhentningsstedfra babysam omhermscorlibvaluestexttilbarns personlige datardgivning1 2610 rdovreet nytlilleafsender dinendelig tidspunkt 30id og fremvistrackinget forventet leveringsgebyrnskernamecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto customerframeworkdomain mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdtobabysam vilhelt afmelde dig8headersubtreeparentnamemenuitemstypecustomerframeworkdomaincmslinkmenuitemcustomerframeworkapplication mscorlibvaluestexttilbehrdagespersonlige data herunderfremviser p vejendelig tidspunktse indholdetblevet fjernetdu kan altidskedu skalfortlleinspiration ogordre kanhjlper digbabysamsammemscorlibvaluestexttilbehr tilafmelde dig klubbenkan gredig somdin profilgratisnr du ermedlemer klarbestillingkommunikationen til dinordre modtagermscorlibvaluestexttilbehrdig ellerallevenligstpolitik om linkbaby brn babysamdkdescriptionbabysamdu modtagergrehvorindklarmedlem acceptererfrardovre tlfnumscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksimageblockog sms babysamkortbaby brner gravid kbaf vores kundeservicebabysamdkdescriptionbabysam erkontakte digdetmscorlibcustomerframeworkdomaincommoncssclass customerframeworkdomainfragtbrandsaltidmedbringe id ogomkringp din13mellem klordre hos3 1 2610p hverdagep vejmatcherog dinflgendemange fysiskeonline ellersamtidigcustomerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksbuttonblockjeresindtastedesortiment via emailsmed et trackog ditdigikkebedstelevereter nubrn babysamdkdescriptionbabysam erlagerfilmodtagertilsendtetilbud fraandet segmentmed etgivertil din ordresetdig og ditdatavalg derpakke er pvil brugese hvornrklar til afhentningskal du vlgemedlem afregistrerettak opretvilmerebabys alderse indholdet smscorlibvaluesvaluetypecustomerframeworkdomaincmsblockstextblockburd senderdu en prferencenamecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdtoog meget meresender en smsgodtproblemer medeller diner danmarksud tildu noglehvor du kansamtalt til digkontakteserandredu bliver medlem4efter kbcustomerframeworkdomain mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdtovi kontaktercustomerframeworkdomain systemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenter centerrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstringfjernet fracenterrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstringcvr nrinden klhelevi kanog megetburdtimes gratisvores mange fysiskerkkesikkerbekrfter3 1trace2legetjfordelenevil duaf klub babysamsom erdinmscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksverticalspacerblockpolitikgiver digom at dinfremmeforvejenomvi mforventet leveringsgebyrfremvis tilsendtesystemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenterinteresseomrder hvordanoveretom babyudstyr ogser udrdovre tlf 7011trace nrhvad erlogget ind predigere dineinformationuddennenogle sprgsmlproduktermed beskedtak opret migforvejen p etdig klubbeninteresseomrderud mellemtilbudvarer i voresdu er loggetemail er registreretdinekontaktet af voresfjernetog duder hjlper digfrdig meder leveret vilcenterrepeatnorepeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringpaddingclassstring namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto customerframeworkdomainos p7011 3010barn25altsparbringerdu nogle sprgsmldu sprgsmlmed besked omud af

Longtail Keyword Density for Babysam.dk

KeywordsOccurences
din pakke er27
med at se24
customerframeworkdomain mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto customerframeworkdomain22
namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto customerframeworkdomain mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto20
centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringpaddingclassstring namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto customerframeworkdomain16
hjlper dig med15
med et track15
e-mail med et15
et track trace14
pakke er leveret14
hvornr din pakke13
se hvornr din13
der hjlper dig13
nr der hjlper13
trace nr der13
track trace nr13
du en e-mail13
ordre modtager du13
din ordre modtager13
afsender din ordre13
vi afsender din13
mscorlibcustomerframeworkdomaincommoncssclass customerframeworkdomain systemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenter12
alle 3 112
centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstring mscorlibcustomerframeworkdomaincommoncssclass customerframeworkdomain12
systemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenter centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstring mscorlibcustomerframeworkdomaincommoncssclass12
customerframeworkdomain systemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenter centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstring12
cvr nr 3137045012
3010 cvr nr12
7011 3010 cvr12
tlf 7011 301012
rdovre tlf 701112
2610 rdovre tlf12
1 2610 rdovre12
3 1 261012
se indholdet s11
du har problemer11
indholdet s klik11
har problemer med11
mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksimageblock11
medlem af klub10
pakke er p8
fremvis tilsendte sms8
og fremvis tilsendte8
klar til afhentning8
nr din pakke7
er klar til7
tilsendte sms med7
id og fremvis7
medbringe id og7
husk at medbringe7
afhentningssted nr din7
til afhentning husk7
pakke er klar7
om at din7
valgte afhentningssted nr7
dit valgte afhentningssted7
til dit valgte7
leveret til dit7
er leveret til7
leveret vil du7
er leveret vil7
vil du modtage7
modtage en sms7
sms med besked7
med besked om7
p tlf 70116
os p tlf6
ringe til os6
du kontakte os6
kan du kontakte6
ind p din6
bliver kontaktet af6
til os p6
customerframeworkapplication mscorlibvaluestexttilbehr til6
nr du er5
graviditet eller din5
du er logget5
barns personlige data5
personlige data herunder5
til at tilpasse5
tilpasse kommunikationen til5
kommunikationen til din5
til din graviditet5
din graviditet eller5
eller din babys5
vil bruge dit5
din babys alder5
alder i overensstemmelse5
babysams politik om5
du kan altid5
kan altid redigere5
altid redigere dine5
redigere dine interesseomrder5
dine interesseomrder hvordan5
interesseomrder hvordan vi5
bruge dit barns5
babysam vil bruge5
vi m kontakte5
fra babysam om5
af klub babysam5
medlem accepterer du5
accepterer du samtidig5
samtidig at modtage5
modtage inspiration og5
inspiration og tilbud5
og tilbud fra5
tilbud fra babysam5
babysam om babyudstyr5
sms babysam vil5
om babyudstyr og5
babyudstyr og andre5
og andre varer5
varer i vores5
vores sortiment via5
sortiment via e-mail5
via e-mail og5
e-mail og sms5
og sms babysam5
hvordan vi m5
dit barns personlige5
m kontakte dig5
eller helt afmelde5
er logget ind5
logget ind p5
klubben nr du5
dig klubben nr5
afmelde dig klubben5
som medlem af5
helt afmelde dig5
til dig og5
til valg af5
dig eller helt5
kontakte dig eller5
din ordre er5
hvor du kan4
p et andet4
mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksverticalspacerblock4
dig og dit4
du vil modtage4
tak opret mig4
opret mig som4
mig som medlem4
centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringcolor-light-grey-bgpaddingclassstring namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto customerframeworkdomain4
mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkapplicationproductsmodelssearchableproductmodel4
link du kan4
kontaktet af vores4
om link du4
politik om link4
overensstemmelse babysams politik4
af vores kundeservice4
levering vil ske4
inden kl 13004
sprgsml kan du4
du sprgsml til4
der passer til3
skal du vlge3
prference for nogle3
dig og din3
et nyt password3
nogle sprgsml kan3
du handler online3
og meget mere3
baby brn babysamdkdescriptionbabysam3
customerframeworkapplicationtitlebabysamdk alt til3
alt til dig3
vores mange fysiske3
af vores mange3
kb online eller3
gravid kb online3
er gravid kb3
som er gravid3
dig som er3
til dig som3
og alt til3
alt til baby3
brnetj og alt3
babyudstyr brnetj og3
kde for babyudstyr3
danmarks strste kde3
er danmarks strste3
babysamdkdescriptionbabysam er danmarks3
brn babysamdkdescriptionbabysam er3
endelig tidspunkt 303
til baby brn3
du en prference3
du bliver kontaktet3
med endelig tidspunkt3
blevet fjernet fra3
du blev ikke3
blev ikke tilmeldt3
ordre hos babysam3
din ordre hos3
du bliver medlem3
bliver medlem accepterer3
data herunder terminsdatoen3
segment s du3
herunder terminsdatoen til3
et forventet leveringsgebyr3
forventet leveringsgebyr vi3
leveringsgebyr vi kontakter3
vi kontakter dig3
kontakter dig efter3
dig efter kb3
s du blev3
andet segment s3
sms med endelig3
du nogle sprgsml3
sender en sms3
bringer ud mellem3
og klar til3
ordre kan du3
din ordre kan3
til din ordre3
er p vej3
et andet segment3
indtastede vrdi er3
ser ud til3
og du vil3
inden for kort3
email er registreret3
registreret i forvejen3
forvejen p et3
sprgsml til din3
mscorlibcustomerframeworkdomaincommoncssclass customerframeworkdomain45
pakke er29
din ordre28
din pakke27
mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto customerframeworkdomain22
customerframeworkdomain mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto22
namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto customerframeworkdomain20
med et19
du kan19
tlf 701118
sms med18
hjlper dig17
customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksverticalspacerblock17
dig med17
et track16
e-mail med16
centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringpaddingclassstring namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto16
kan du15
til din15
er leveret14
du har14
nr der14
track trace14
modtager du13
vi afsender13
alle 313
afsender din13
ordre modtager13
fra babysam13
trace nr13
der hjlper13
se hvornr13
hvornr din13
af klub12
klar til12
nr 3137045012
cvr nr12
3010 cvr12
2610 rdovre12
7011 301012
centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstring mscorlibcustomerframeworkdomaincommoncssclass12
1 261012
3 112
besked om12
til dig12
customerframeworkdomain systemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenter12
rdovre tlf12
systemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenter centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstring12
har problemer11
problemer med11
se indholdet11
nr du11
customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblockstextblock11
indholdet s11
klub babysam11
customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksimageblock11
er ikke11
s klik11
du er10
er p10
medlem af10
p din10
du fr10
leveret til9
du vil9
har du9
dig og9
fremvis tilsendte8
tilsendte sms8
dit barns8
og fremvis8
til afhentning8
du modtage8
til dit8
vil du8
valgte afhentningssted7
er nu7
nr din7
leveret vil7
med besked7
er klar7
s du7
af vores7
afhentning husk7
medbringe id7
afhentningssted nr7
id og7
e-mail og7
dit valgte7
alt til6
customerframeworkapplication mscorlibvaluestexttilbehr6
fr du6
logget ind6
ind p6
valg af6
mscorlibvaluestexttilbehr til6
customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksbuttonblock6
p tlf6
os p6
bliver kontaktet6
til os6
vores sortiment6
du bliver6
via e-mail6
ringe til6
du samtidig6
hvor du6
afmelde dig6
og f6
kontaktet af6
kontakte os6
du kontakte6
p vej6
du sprgsml5
og du5
er allerede5
du allerede5
som medlem5
ordre er5
hos babysam5
et andet5
vi har5
din babys5
sortiment via5
babysam om5
bruge dit5
vil bruge5
babysam vil5
sms babysam5
og sms5
er logget5
andre varer5
og andre5
babyudstyr og5
om babyudstyr5
tilbud fra5
data herunder5
og tilbud5
inspiration og5
modtage inspiration5
accepterer du5
medlem accepterer5
til valg5
mellem kl5
du handler5
skal du5
er blevet5
barns personlige5
personlige data5
tilpasse kommunikationen5
redigere dine5
klubben nr5
dig klubben5
helt afmelde5
eller helt5
dig eller5
kontakte dig5
m kontakte5
vi m5
hvordan vi5
interesseomrder hvordan5
dine interesseomrder5
altid redigere5
kan altid5
politik om5
babysams politik5
babys alder5
der er5
eller din5
graviditet eller5
din graviditet5
kommunikationen til5
et nyt5
vil ske4
venligst et4
customerframeworkapplication mscorlibvaluestextautostole4
centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringcolor-light-grey-bgpaddingclassstring namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto4
customerframeworkdomain mscorlibvaluesvaluetypecustomerframeworkapplicationproductsmodelssearchableproductmodel4
vil modtage4
som er4
sprgsml til4
levering vil4
kl 13004
inden kl4
p hverdage4
sprgsml kan4
leveringsdag hvor4
vores kundeservice4
venligst dit4
ordre kan4
fragt til4
tak opret4
rd til4
mig som4
ud til4
favoritter p4
tilbud til4
vores mange4
og dit4
dit valg4
opret mig4
levering til4
er registreret4
mail med4
hvad du4
du skal4
p et4
til butik4
passer til4
email er4
du modtager4
og din4
overensstemmelse babysams4
dit kb4
ikke lngere4
dig vores4
link du4
er et4
din bestilling4
om link4
aftale endelig4
handler online3
du vlge3
nogle bestemte3
profil p3
tidspunkt 303
password til3
burd sender3
har endnu3
med endelig3
endelig tidspunkt3
nyt password3
din profil3
har set3
der passer3
babyudstyr brnetj3
giver dig3
mange fysiske3
online eller3
kb online3
gravid kb3
er gravid3
dig som3
og alt3
brnetj og3
strste kde3
valg der3
danmarks strste3
er danmarks3
babysamdkdescriptionbabysam er3
brn babysamdkdescriptionbabysam3
baby brn3
til baby3
customerframeworkapplicationtitlebabysamdk alt3
bringer ud3
times gratis3
ud mellem3
hvad er3
medlemstilbud og3
forventet leveringsgebyr3
blevet fjernet3
fjernet fra3
kurven pga3
denne e-mail3
herunder terminsdatoen3
terminsdatoen til3
nogle sprgsml3
du nogle3
et forventet3
leveringsgebyr vi3
bliver medlem3
og klar3
vi kontakter3
ordre hos3
vlge et3
kontakter dig3
dig efter3
efter kb3
er din3
p alle3
forhold til3
du et3
vre medlem3
og meget3
vi kan3
meget mere3
du nsker3
med fragtmand3
kan gre3
venligst din3
et tracking3
indtastede vrdi3
vrdi er3
os hvad3
ser ud3
vi sender3
ud af3
mere om3
forvejen p3
andet segment3
segment s3
du blev3
blev ikke3
ikke tilmeldt3
hvis du3
og vi3
customerframeworkapplication mscorlibvaluestexttil3
du203
til185
customerframeworkapplication172
er145
og142
customerframeworkdomain132
din126
med112
p89
dig75
vi61
har58
af54
kan53
babysam52
et51
nr48
om48
mscorlibcustomerframeworkdomaincommoncssclass45
dit44
ikke36
vil35
ordre35
eller34
der32
s31
pakke31
vores29
se28
e-mail27
sms26
modtager25
fra25
som24
det24
os24
dine22
mscorlibvaluesordernum0contentblockstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockdto22
medlem21
leveret21
modtage20
alle20
klub20
namecontentblockgroupstypesystemcollectionsgenericlist1customerframeworkdomaincmscontentblockgroupdto20
fr20
019
tlf19
denne19
mere19
skal18
hjlper18
venligst18
track17
mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksverticalspacerblock17
trace16
ved16
centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringpaddingclassstring16
bliver15
sprgsml14
besked14
114
hos13
hvornr13
213
afsender13
valg13
via13
den13
ind12
alt12
312
rdovre12
allerede12
ud12
butik12
varer12
cvr12
klik12
centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringtotalunits24rowconfigurationequalcolumnheightsfalseparallaxbehaviourstringnoneexpandtofullwidthfalseclassestypesystemlinqenumerablewhereselectarrayiterator2systemstring12
412
systemcorevalueslayerconfigurationlayerstyle0enablemultiplelayersfalselayerdurationnullbackgroundconfigurationbackgroundimagedefaultchosenfilenulldefaultchosenfile2xnullmobilechosenfilenullmobilechosenfile2xnullimageplacementcenter12
f12
512
klar12
flere11
kb11
hvor11
kontakte11
amp11
ogs11
venlig11
mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksimageblock11
her11
nsker11
vlge11
mscorlibvaluesvaluetypecustomerframeworkdomaincmsblockstextblock11
indholdet11
problemer11
link10
hvordan10
tilbud10
hvad10
aftale10
vre9
valgte9
sender9
nogle9
nu9
nyt9
kl9
levering9
efter9
helt9
inden9
gratis9
lngere8
email8
husk8
fremvis8
afhentning8
barns8
andre8
babyudstyr8
blevet8
tilsendte8
varen8
endelig8
klubben8
meget8
afmelde7
tak7
fragt7
password7
id7
m7
medbringe7
fordele7
afhentningssted7
rdgivning7
fri7
handler7
kort7
herunder7
data7
accepterer7
mail7
tid7
rd7
giver6
mscorlibvaluestexttilbehr6
behov6
rdgiver6
mest6
vej6
mscorlibvaluesvaluetypecustomerframeworkdomaincmsblocksbuttonblock6
vare6
hvis6
ringe6
bestilling6
op6
produkter6
profil6
bemrk6
overensstemmelse6
mellem6
online6
kundeservice6
interesseomrder6
kontaktet6
samtidig6
sortiment6
favoritter6
bruge6
personlige6
flgende6
politik6
altid6
logget6
matcher6
andet5
ansgning5
inspiration5
opret5
mig5
tilmeldt5
babysams5
registreret5
betyder5
pga5
samt5
tager5
hverdage5
ssom5
vide5
muligt5
ny5
blive5
booking5
alder5
babys5
graviditet5
kommunikationen5
tilpasse5
ske5
65
brands5
ordrer5
redigere5
jeres4
leveres4
centerrepeatno-repeatbackgroundcolorstringbackgroundcolorstylestringbackgroundclassstringcolor-light-grey-bgpaddingclassstring4
mscorlibvaluestextautostole4
leveringsdag4
sendes4
gre4
hele4
25altspar4
74
prismatch4
deltage4
oslinktypeinternallinkchildrenmenuitemclassisselectedfalsetypecustomerframeworkdomaincmslinkmenuitem4
kunne4
lagerfil4
mscorlibvaluesvaluetypecustomerframeworkapplicationproductsmodelssearchableproductmodel4
under4
outerwear4
forventet4
jer4
lille4
sikker4
fordelene4
times4
godt4
sendt4
passer4
krav4
mange4
baby4
ser4
fejl4
bedst4
events4
set4
informeres4
gr4
babybox4
medlemstilbud4
kurven4
termotj4
dkkp4
babysamdk4
gyldig4
over4
betaling4
annullere3
bestemte3
prference3
leg3
annulleret3
mske3
tidspunkt3
fysiske3
burd3
sete3
gerne3
bringer3
legetj3
headersubtreeparentnamemenuitemstypecustomerframeworkdomaincmslinkmenuitem3
ingen3
disse3
danmarks3
customerframeworkapplicationtitlebabysamdk3
bedste3
brn3
kalder3
fremme3
babysamdkdescriptionbabysam3
rkke3
strste3
lidt3
kde3
brnetj3
stillede3
oplysningerne3
endnu3
gravid3
test3
dem3
dages3
fragtmand3
lavt3
83
navn3
bekrfter3
stokke3
forhold3
populre3
udvalgte3
fjernet3
kvittering3
rente3
belb3
derfor3
kassen3
opdateret3
afslutte3
1-33
automatisk3
terminsdatoen3
kontakter3
kurv3
blev3
information3
kommer3
hver3
tracking3
kun3
fortlle3
leveringsgebyr3
indtastede3
vrdi3
men3
bde3
samme3
hjere3
familie3
brug3
hjemme3
barn3
mit3
omkring3
forvejen3
segment3
behandler3
mscorlibvaluestexttil3

Who hosts Babysam.dk?

Babysam.dk Hosting Provider Information

Hosted IP Address:91.215.161.129
Hosted Hostname:91.215.161.129
Service Provider:Athena IT-Group A/S
Hosted Country:DenmarkDK
Location Latitude:56.1702
Location Longitude:9.5449
Webserver Software:Not Applicable

Is "Athena IT-Group A/S" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
Athena IT-Group A/S
0.0005%

HTTP Header Analysis for Babysam.dk

Http-Version: 1.1
Status-Code: 302
Status: 302 Found
Cache-Control: no-cache
Content-length: 0
Location: https://babysam.dk/
Connection: close

Babysam.dk Domain Nameserver Information

HostIP AddressCountry
ns02.athena-hosting.dk 91.193.137.92Denmark Denmark
ns03.athena-hosting.dk 91.193.137.93Denmark Denmark
ns01.athena-hosting.dk 91.193.138.91Denmark Denmark


Need to find out who hosts Babysam.dk?


Domain Registration (WhoIs) information for Babysam.dk

 # Hello 134.122.98.67. Your session has been logged.
#
# Copyright (c) 2002 - 2020 by DK Hostmaster A/S
#
# Version: 4.0.2
#
# The data in the DK Whois database is provided by DK Hostmaster A/S
# for information purposes only, and to assist persons in obtaining
# information about or related to a domain name registration record.
# We do not guarantee its accuracy. We will reserve the right to remove
# access for entities abusing the data, without notice.
#
# Any use of this material to target advertising or similar activities
# are explicitly forbidden and will be prosecuted. DK Hostmaster A/S
# requests to be notified of any such activities or suspicions thereof.

Domain: babysam.dk
DNS: babysam.dk
Registered: 1997-01-10
Expires: 2023-03-31
Registration period: 5 years
VID: no
DNSSEC: Unsigned delegation, no records
Status: Active

Nameservers
Hostname: ns01.athena-hosting.dk
Hostname: ns02.athena-hosting.dk
Hostname: ns03.athena-hosting.dk

Websites with Similar Names

Babys-babys.ru
?????????? ? ??????
Babys-bay.com
Apache2 Ubuntu Default Page: It works
Babys-bestes.com
ᑕ❶ᑐ Babynahrung Test 2020 + Top 5 + Preis Vergleich + NEUBabys Bestes… alles Rund um Babynahrung
Babys-breath.org
404 Not Found
Babys-cars.info
STRATO - Domain reserved
Babys-class.com
HOME | baby's class
Babys-closet.com
Registrant WHOIS contact information verification | Namecheap.com

Recently Updated Websites

Yayu1404.vip (1 second ago.)Chunyingwu.com (2 seconds ago.)Escape.group (3 seconds ago.)Aoavip1156.app (3 seconds ago.)Doublesuperstake.com (4 seconds ago.)Mastersdegreeusa.com (4 seconds ago.)Stockdronez.com (5 seconds ago.)94thsfs.com (5 seconds ago.)Harnovvs.com (5 seconds ago.)Socsicecream.net (5 seconds ago.)Holisticbeauty-wellnesscenter.com (5 seconds ago.)Wakeup-soul.com (5 seconds ago.)Yibovip2706.com (6 seconds ago.)Weirdobeardo.org (6 seconds ago.)Sharvayaengineering.com (6 seconds ago.)Kcr.ie (6 seconds ago.)Cnyx17.com (6 seconds ago.)Herfirstlesbiansex.com (6 seconds ago.)Ustechproducts.com (7 seconds ago.)Bestjacksonvilleplumbing.com (7 seconds ago.)Mtbikefilmtour.com (7 seconds ago.)Myseaincekum.com (8 seconds ago.)Kitchenbathimages.com (8 seconds ago.)Sleeptoday.us (9 seconds ago.)Opportunitysignals.com (9 seconds ago.)Sportxxxaci.com (9 seconds ago.)Lekkihub.com (9 seconds ago.)Pkw-autoteile.de (9 seconds ago.)Hardwareheaven.com (9 seconds ago.)M2dmanagement.com (10 seconds ago.)

Recently Searched Keywords

membership details 038 (1 second ago.)charge case (2 seconds ago.)nbsp (3 seconds ago.)dlength (4 seconds ago.)neuearialsans-seriffont-size18pxline-height14emtext-transformnoneletter-spacing02emfont-weightnormalfont-stylenormalcolor333sqs-slide-wrapperdata-slide-typecover-page (7 seconds ago.)動画 染めた髪 アイルランド人 ダブル挿入 (7 seconds ago.)-webkit-border-radius 0px (8 seconds ago.)austos 2019 pazartesi (9 seconds ago.)http server (9 seconds ago.)yoga alliance (10 seconds ago.)scout notes (12 seconds ago.)khng hi (12 seconds ago.)横浜市 (13 seconds ago.)sushi in the city (14 seconds ago.)official youtube channel (16 seconds ago.)get a free flight and work remotely from hawaii (19 seconds ago.)honda civic car (19 seconds ago.)2082254238shahara (20 seconds ago.)return (20 seconds ago.)терминал (21 seconds ago.)网易云课堂 (22 seconds ago.)7 4842 (24 seconds ago.)asian teen (25 seconds ago.)एकपात्री नाटकं (27 seconds ago.)block border 4px (28 seconds ago.)marybakereddybicentennial (29 seconds ago.)2019 05-28 2019 (30 seconds ago.)ddocumentmode (32 seconds ago.)more commercial (32 seconds ago.)17px14em brandon-grot-w01-lightsans-serif (34 seconds ago.)