Sammenlign lån | Find billigste lån her | Bankly

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Sammenlign lån fra flere banker med én ansøgning på Bankly – Vi samler tilbuddene for dig – Lån op til 500.000 kr. – Ansøg gratis og uforpligtende.



Domain summary

Last updated
2021-06-17
Domain label
bankly
Domain extension
dk
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Bankly.dk registered?
A: Bankly.dk was registered 4 months, 1 week, 1 day, 14 hours, 11 minutes, 15 seconds ago on Thursday, June 17, 2021.
Q: When was the WHOIS for Bankly.dk last updated?
A: The WHOIS entry was last updated 4 months, 1 week, 1 day, 14 hours, 11 minutes, 15 seconds ago on Thursday, June 17, 2021.
Q: What are Bankly.dk's nameservers?
A: DNS for Bankly.dk is provided by the following nameservers:
  • ns2.digitalocean.com
  • ns3.digitalocean.com
  • ns1.digitalocean.com
Q: Who is the registrar for the Bankly.dk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Bankly.dk?
A: Bankly.dk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Bankly.dk each day?
A: Bankly.dk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Bankly.dk resolve to?
A: Bankly.dk resolves to the IPv4 address 165.22.192.66.
Q: In what country are Bankly.dk servers located in?
A: Bankly.dk has servers located in the Netherlands.
Q: What webserver software does Bankly.dk use?
A: Bankly.dk is powered by Nginx/1.17.3 webserver.
Q: Who hosts Bankly.dk?
A: Bankly.dk is hosted by Hewlett-Packard Company in North Holland, Amsterdam, Netherlands, 1098.
Q: How much is Bankly.dk worth?
A: Bankly.dk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Bankly.dk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Bankly.dk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Bankly.dk

H1 Headings

1 :
  1. Sammenlign lån fra flere banker.

H2 Headings

29 :
  1. Bankly finder det billigste lån
  2. Mere end 30.000 glade brugere
  3. Hvad skal vi hjælpe dig med?
  4. Vi sammenligner disse banker for dig
  5. Vores rådgivere er klar til at hjælpe dig
  6. Mere om økonomi & lån
  7. Lån penge nemt og hurtigt hos Bankly
  8. Spar penge ved at tage et samlelån
  9. Vil du gerne låne til bolig?
  10. Måske passer et andelsboliglån bedre?
  11. Find det billigste huslån hos Bankly
  12. Lån til indskuddet i din bolig hos Bankly
  13. Bliv gældfri hurtigst muligt
  14. Lån til en ny båd hos Bankly
  15. Find det billigste banklån her
  16. Tag et billigt billån hos Bankly
  17. Du kan også låne til MC
  18. Lån til campingvogn
  19. Find markedets absolut billigste lån hos Bankly
  20. Mangler du penge til ferien?
  21. Hvad kan jeg låne til?
  22. Hvor hurtigt kan jeg tage et lån?
  23. Er det muligt at tage et lån som ung studerende?
  24. Find det bedste kontantlån på få minutter
  25. Lån til indfrielse af gæld
  26. Du kan også låne uden sikkerhed
  27. Kredit-lån - løsningen til dine finansielle problemer?
  28. Få styr på din økonomi, før du låner
  29. Kan jeg indfrie mit lån før tid?

H3 Headings

4 :
  1. Ændring nødvendig
  2. Sammenlign flere banker med kun én uforpligtende ansøgning.
  3. Nyt lån - Sammenlign og vælg rigtigt
  4. Samlelån - Spar penge på dine nuværende lån

H4 Headings

7 :
  1. Sådan fungerer det
  2. Kundeservice
  3. Tjenester
  4. Ressourcer
  5. Boliglån
  6. Lån
  7. Andre lån

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

8 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

72:

Links - Internal (nofollow)

0:

Keyword Cloud for Bankly.dk

du kan ogsbilligt lndin gldrigtighjlpethisbankmenuselectedbanksbilligste huslnsum thisformrequestconsolidateadditionalamount thisconsolidationminamountdatanogetgtokenfind det billigstegerne vilvenligstdu altst0 thisformloansforeachitembanklyaxioshusln16rateformlbilligeredebitorrenteog godthiscarloandownpaymentmaxamount thisformrequestcarpricethisformrequestcarprice 10du gerne vil6hosfrtilnullthisconsolidationminamount sumdennedisclaimeramounttorepaythisbankmenucurrentitemthisclickeddetaxios methodydelse computedrate nsteskal lnehjerelnetilbud fravalsamlenewhar styrbede omvariabel debitorrenteindtasteter ikke indtastettilbagebetaling disclaimeramounttorepayvlge det bedstedet billigsteindskuddet i dinthisformloanselse ifnemligtil indfrielse afrate op disclaimercalculateyearlyandetlneherdu har styrsamlet tilbagebetaling disclaimeramounttorepayikke haralle1thisformrequestcarprice thisformrequestdownpaymenterbrformrequestpaymenttimeetb omkascliddebitorrente formtype carloanln til indfrielsenogenmethodansgevlgerthisstartedthisapplicationpageet forbrugslnkreditomkostninger disclaimertotalcostofloanwindowgathisformrequestconsolidateadditionalamount thisconsolidationminamountomif thisformtypebilligtthisconsolidationmaxamountheltsamletthisisvalidfielditemtypeghos banklyhvad kansum itemamountdu frkreditomkostninger disclaimertotalcostofloan 14lne pengecampingvogndermedfalse thisformrequestconsolidateadditionalamounttil indskuddetnyt lnstartedr mnedlig ydelsefinansiellebilligste0pengenefra flerejathisloandefaultamountnull pidstyr pom banklycomputeamountformrequestloanamountfalse ifbillnthisformrequestloanamountvihar styr pikke indtastetdisseforbrugslnthisrangesliderinitcarpricedages fortrydelsesretansgningloginnr duda dumanglerkontaktnstesamlet kreditbelbmed etvigtigt at duhar modtagetlocalstorageremoveitemutmog s9hurtigst muligtog detstedetindadskillige bankerdette ertil boligsamlederejsethisformrequestloanpurpose samlelnapplicantaf pandregrecaptchaexecute6ldsvlqzaaaaala6jaggkeqjzykvmlrtuwz4qpr action submit8211 eller hvisif thisformrequestloanpurposefra andredu betalerformrequestpaymenttime 12carloan ratecarviderestedet skaldisclaimerestablismentcost samlet tilbagebetalingden billigstethiserrorconsolidateadditionalamount70 60 65thisformrequestcarprice 10 8fortrydelsesretthisformrequestconsolidateadditionalamount thisconsolidationminamount sum8indfrielse afthisformrequestloanpurposetagermuligtvalue ifdisclaimertotalcostofloandet erlavepriseksempel samletamount 0indexog det erderfor er detif userdatarequestloanpurposeet lndin ansgningnfindeetb omk disclaimerestablismentcosteller hvis dutilbagebetaling disclaimeramounttorepay samledetage etdettevil dufunctioncomputedrate nstethiscarloandownpaymentmaxamountgldfriharcomputeamountformrequestloanamount lbetid formrequestpaymenttimedu kanthisformutm sourcebankerthisformrequestcaryearog derfor erboligvariabel debitorrente formtypevigtigtfinderdisclaimertotalcostofloan 14computedrateudbetalingnemt og hurtigtselvnew datedisclaimeramounttorepay samlede kreditomkostninger8211 detlangtbankernedagesinfobanklydkthisconsolidationminamount sum thisformrequestconsolidateadditionalamounter etln penge12 mdr variabelenkeltln penge samlelnkbesum 0indhenteomk disclaimerestablismentcostbilligste lnvlgederestokenpriseksempelkan ogs lnedisclaimercalculateyearly etb14thisformutmgrecaptchaexecute6ldsvlqzaaaaala6jaggkeqjzykvmlrtuwz4qprthisrangesliderinitloanamountbedrethisformrequestconsolidateadditionalamount thisconsolidationmaxamountendhvis duer derbankenhjlpe dig medthisrangesliderinitdownpaymentdu ansger omif thisformtype loanthisformrequestconsolidateadditionalamount 0nyterrorcountmarkedets absolut billigsteansgningenbankly hvisactiongrecaptchaexecute6ldsvlqzaaaaala6jaggkeqjzykvmlrtuwz4qpr actionmdrindfrielsenemtfleretil indfrielsebruge pengenethisformrequestpaymenttime 1 thisformrequestpaymenttimemnedligsammenlignehar dudit lnrate opthisformrequestloanpurpose billningenresponsedatagauseridsum thisformrequestconsolidateadditionalamountvalue nullfindisrln 8211du ikke hartypeof windowgagetall functionhvis du ikkeudenthisformapplicantssnthisstarted trueindfrielse af gldtypiskdu pengeskalbanklnblog om banklysamlelnog dermedpotentieltdu penge tilfratransidssntilbagebetalingkan dupriseksempel samlet kreditbelbatgd15thistempdownpayment38211 og dermedkanudnux12der eksempelvisdogdet bedstenydu tager etansgkan jeg lnecomputeamountformrequestloanamount lbetidgodbedsteln til campingvognln du14 dageset samlelnoplne udendu ertage et lnaction submit thengtokenforskelligeden0 ifdisclaimeramounttorepay samledegiverif thisformloanslength 0skal brugetager et5selvflgeligaction submitdanskereop disclaimercalculateyearly etbfdet bedste tilbudmaj 2021uden sikkerhednull ifbankly hvis dukravkan du nemligregistreretudfyldeer dogthisformrequestloanamount thisformrequestcarprice thisformrequestdownpaymentsamlet kreditbelb computeamountformrequestloanamountbruge banklycampaignkreditbelb computeamountformrequestloanamount lbetidadskilligemarkedets absoluttil diglndisclaimertotalcostofloan 14 dages10 8sumrettedermed kanansger omlet sum 0har etindskuddeteksisterende lnnsker at lneelseet andelsboliglnln ogansge omthisformleadapplicationidunderskriveskal bruge pengeneln du betalerdu ikkekontant udbetalingguessroundsdebitorrente formtypenskervalue if valuebetalerthisformrequestdownpaymentlavere rentejeg lnelbetid formrequestpaymenttimederdin boliglnetilbudmnedlig ydelse computedrate0 letpenge samleln billnformrequestpaymenttime 12 mdrthisformrequestconsolidatedebtmcrentefinansieringtilbud fradu nskertypeconstsmedium12 mdrresbruge pengene pfr dugernevilthisformrequestconsolidateadditionalydelsebr dusetsammedine tilbudthisformrequestloanamount thisformrequestcarpricedisclaimerestablismentcostnull campaignalleredeif thisformtype consolidationln sompositive falsecarloan ratecar ratedisclaimercalculateyearly etb omkrmskeop tilbankpengene puforpligtendelnebelbmdr variabelkrkundeservicethisclicked trueif windowgarkiformrequestpaymenttime r mnedlig2et ln somthisformrequestpaymenttimedu viletet parlne digspar pengeamountthisclicked falsesom duthisbanksmenucloselbetid formrequestpaymenttime 12har rdnemt ogdard tilrdthisformvalue returnlet sumdisclaimercalculateyearlynrconsolidationthisformrequestconsolidateadditionalamountthisformloansindexlenderdu lnerder eransgeraltsindtastet korrektlbetid formrequestpaymenttime ralle dine lnifsum thisformrequestconsolidateadditionalamount thisconsolidationmaxamountkonomisettimeoutsikkerhedpengene tiletbbedste tilbudwindowlocationhref thisapplicationpagelnertil dinrente for alleeventcarloanf minutterthisformrequestpaymenttime 1tilbagebetalingstidenmodtagethvornrdisclaimerestablismentcost samletthisformrequestloanamount thisloandefaultamountif valuethiserrorcaryeargldsberegnerpasserlne tilkun17thisisvalidfielditemlenderpenge samlelnmnedlig ydelsehar rd tilelse thisclickedgldgclidefterabsolut billigstebenyttedu gernehvisindenforvarparmdeditmendinesourcehurtigtln fr tidprivatkonomiln tilnemmereer vedvlgvremasse18thisisvalidfieldthisformrequestcaryeareksisterende8211 ogvaluefr tidmegetindfriegratisthisformrequestpaymenttime 12thengtokenmed detboliglntilbudenetil kontant udbetalingr mnedligsom derlt19true ifthisconsolidationminamountif thisformtype carloaneksempelvisfrste8211 elleremailogslnetjegthiscarloandownpaymentmaxamount thisformrequestcarprice 10vednuvrendehurtigt kanthiserrorloanpurposethisformloansforeachitemog du70 60op disclaimercalculateyearlykreditlnsettimeout thisrangesliderinitcarpriceer detog derforfind detganskedu har modtaget10delwindowgagetall functionthisformloanslength 0til at betaleblogsom der eksempelviswindowga typeof windowgagetallsparer ikkediglne til boligydelse computedrateossamleln billnurlvoresaltidstillewindowlocationhrefreturnfra flere bankerfirstnamedu i stedetsubmitbetyderthisformtype loanbdvlge detthisisvalidcurrencyitemamounthvorif thisformloanslengthmajloanpurposetil kontantsjldentlettypeofsparekontantlnlenderformrequestpaymenttime rdindu selvflgeligabsolut7andelsboliglnrenterbruge60 65igennemelleromk disclaimerestablismentcost samlettil dinekreditomkostningermdr variabel debitorrentetypeof windowgagetalldu nemligkunneaf gldnull mediumdermed har13hurtigsttidln frstyr p dinstyrmedsederfor erkreditbelbpenge tilguessblog omwindowga typeofmarkedetsfinansiere14 dages fortrydelsesrettimeritemamountherefters dudig medomkdu blotafduhurtigthisformrequestcarpricelastguessformtypevariabelif windowga typeofminutteruserdatarequestdownpaymentblotkan ogssparerskal dukorrektln hosdin konomialtbelbhjlpe digratecarogdine lnp din konomilastnamedu vlgerlastresgratis uforpligtendehvis du harfalseformsammenlignuserdatarequestloanpurposedu haret budgetthisformrequestdownpayment thisformrequestdownpaymentthisformtype consolidationpositivehvadtotalretpidnogen formheletil bankerne0 thisformloansratecar rate opn ansgningbedenewdatathisformtypemeredin bankbudgetdateandenthisbankmenucurrentitem 0hvad kan jeglender nullmangeloansomdig somderforkontant8211 s4kreditbelb computeamountformrequestloanamountog hurtigtoverdu typiskom etsettimeout thisrangesliderinitloanamountgrsammenlign nusubmit thengtokentilbuddu ansgerratecar ratep dincomputedrate nste gratiskan jegphoneanmeldelsersamlede kreditomkostningermange danskerethisformloanslengthsamlede kreditomkostninger disclaimertotalcostofloaningen kravwindowgagetalltilbuddeneferienste gratisbildu skalnr du tageret billigtformtype carloan60 65 66thisformcreatedatnr du harikkehos bankly hvisthenresponsesamlet tilbagebetalinghvis du erlavere65 661 thisformrequestpaymenttimetagemasse pengeindex ifogs lnelbetidpfaktiskthisformtype carloanalle dineflere lntil campingvognbetale11tage et samleln500000 krderudoverhvilketformtype carloan ratecarnste gratis uforpligtendetrueflere bankereller hvisnull transiditemikke indtastet korrektindtasthavepengehvad dudu tager

Longtail Keyword Density for Bankly.dk

KeywordsOccurences
tage et ln9
nr du har9
du i stedet7
styr p din7
p din konomi6
if thisformtype carloan6
det bedste tilbud6
hvis du har6
sum thisformrequestconsolidateadditionalamount thisconsolidationminamount5
du tager et5
if thisformloanslength 05
kan jeg lne5
du har modtaget5
computeamountformrequestloanamount lbetid formrequestpaymenttime5
nr du tager5
du kan ogs5
vigtigt at du5
alle dine ln4
til kontant udbetaling4
if thisformtype loan4
indfrielse af gld4
thiscarloandownpaymentmaxamount thisformrequestcarprice 104
thisformrequestcarprice 10 84
til indfrielse af4
sum thisformrequestconsolidateadditionalamount thisconsolidationmaxamount4
vlge det bedste4
ln til indfrielse4
find det billigste4
ln til campingvogn4
kan ogs lne4
hvis du ikke4
har rd til4
8211 eller hvis4
eller hvis du4
disclaimertotalcostofloan 14 dages4
derfor er det4
14 dages fortrydelsesret4
ln penge samleln4
kreditomkostninger disclaimertotalcostofloan 144
lbetid formrequestpaymenttime 124
ratecar rate op4
carloan ratecar rate4
formtype carloan ratecar4
debitorrente formtype carloan4
variabel debitorrente formtype4
samlede kreditomkostninger disclaimertotalcostofloan4
12 mdr variabel4
formrequestpaymenttime 12 mdr4
kreditbelb computeamountformrequestloanamount lbetid4
op disclaimercalculateyearly etb4
samlet kreditbelb computeamountformrequestloanamount4
priseksempel samlet kreditbelb4
mnedlig ydelse computedrate4
r mnedlig ydelse4
formrequestpaymenttime r mnedlig4
lbetid formrequestpaymenttime r4
fra flere banker4
60 65 664
70 60 654
rate op disclaimercalculateyearly4
mdr variabel debitorrente4
disclaimercalculateyearly etb omk4
etb omk disclaimerestablismentcost4
disclaimeramounttorepay samlede kreditomkostninger4
tilbagebetaling disclaimeramounttorepay samlede4
samlet tilbagebetaling disclaimeramounttorepay4
disclaimerestablismentcost samlet tilbagebetaling4
omk disclaimerestablismentcost samlet4
ln fr tid4
penge samleln billn3
som der eksempelvis3
du ikke har3
computedrate nste gratis3
til at betale3
ydelse computedrate nste3
og det er3
thisconsolidationminamount sum thisformrequestconsolidateadditionalamount3
hvis du er3
bruge pengene p3
skal bruge pengene3
et ln som3
hos bankly hvis3
nsker at lne3
ikke indtastet korrekt3
er ikke indtastet3
thisformrequestpaymenttime 1 thisformrequestpaymenttime3
8211 og dermed3
du penge til3
blog om bankly3
du har styr3
har styr p3
bankly hvis du3
indskuddet i din3
let sum 03
thisformrequestloanamount thisformrequestcarprice thisformrequestdownpayment3
ln du betaler3
typeof windowgagetall function3
hvad kan jeg3
nemt og hurtigt3
windowga typeof windowgagetall3
if windowga typeof3
action submit thengtoken3
tage et samleln3
grecaptchaexecute6ldsvlqzaaaaala6jaggkeqjzykvmlrtuwz4qpr action submit3
rente for alle3
kan du nemlig3
if thisformtype consolidation3
lne til bolig3
du gerne vil3
thisformrequestconsolidateadditionalamount thisconsolidationminamount sum3
du ansger om3
hjlpe dig med3
value if value3
nste gratis uforpligtende3
markedets absolut billigste3
og derfor er3
hvis du32
nr du23
kan du20
du har20
et ln19
tage et17
hos bankly16
du kan16
ln til15
if thisformtype14
det er14
er det13
kan jeg12
du nemlig10
fr du10
sum thisformrequestconsolidateadditionalamount10
du ikke10
lne til10
8211 og10
og derfor9
du nsker9
skal du9
du skal9
thisformtype carloan9
lbetid formrequestpaymenttime8
bedste tilbud8
det bedste8
if value8
om et8
du er8
penge til7
din konomi7
det billigste7
thisformtype loan7
thisformrequestcarprice 107
fr tid7
styr p7
p din7
ln penge7
flere banker7
tilbud fra7
et samleln6
find det6
value if6
vlge det6
value return6
else if6
og dermed6
da du6
br du6
gratis uforpligtende6
ln du6
og du5
thisformtype consolidation5
lnetilbud fra5
if thisformloanslength5
thisformloanslength 05
har modtaget5
8211 det5
dit ln5
8211 eller5
ln hos5
er der5
du tager5
tager et5
thisformrequestconsolidateadditionalamount thisconsolidationminamount5
bruge pengene5
du alts5
ogs lne5
billigste ln5
et par5
til dig5
jeg lne5
kan ogs5
skal lne5
du gerne5
computeamountformrequestloanamount lbetid5
spar penge4
samlet kreditbelb4
priseksempel samlet4
dine ln4
samlet tilbagebetaling4
alle dine4
et billigt4
kreditbelb computeamountformrequestloanamount4
lne penge4
hvad du4
hjlpe dig4
nemt og4
uden sikkerhed4
penge samleln4
s du4
med det4
du fr4
du lner4
12 mdr4
formrequestpaymenttime 124
af gld4
du betaler4
60 654
rd til4
har rd4
ikke har4
din bolig4
til indskuddet4
derfor er4
til campingvogn4
8211 s4
din gld4
70 604
eller hvis4
ln 82114
65 664
vil du4
fra flere4
et forbrugsln4
til indfrielse4
indfrielse af4
et budget4
maj 20214
pengene til4
din ansgning4
formrequestpaymenttime r4
r mnedlig4
mnedlig ydelse4
til bankerne4
ydelse computedrate4
value null4
disclaimerestablismentcost samlet4
ln fr4
false if4
omk disclaimerestablismentcost4
etb omk4
thisstarted true4
du penge4
disclaimercalculateyearly etb4
til kontant4
kontant udbetaling4
eksisterende ln4
true if4
ln som4
thisformrequestcarprice thisformrequestdownpayment4
14 dages4
er ikke4
thisformrequestdownpayment thisformrequestdownpayment4
0 thisformloans4
op disclaimercalculateyearly4
rate op4
ratecar rate4
10 84
debitorrente formtype4
thiscarloandownpaymentmaxamount thisformrequestcarprice4
formtype carloan4
dages fortrydelsesret4
carloan ratecar4
tilbagebetaling disclaimeramounttorepay4
mdr variabel4
samlede kreditomkostninger4
0 thisformloansforeachitem4
thisformrequestconsolidateadditionalamount thisconsolidationmaxamount4
kreditomkostninger disclaimertotalcostofloan4
disclaimertotalcostofloan 144
0 if4
disclaimeramounttorepay samlede4
variabel debitorrente4
stedet skal3
ansger om3
indtastet korrekt3
du ansger3
gerne vil3
er ved3
du typisk3
til bolig3
dette er3
der er3
null medium3
af p3
null campaign3
masse penge3
null pid3
null transid3
om bankly3
blog om3
samleln billn3
har styr3
et andelsboligln3
ingen krav3
ikke indtastet3
er dog3
pengene p3
som der3
og s3
du selvflgelig3
der eksempelvis3
hurtigt kan3
lne dig3
billigt ln3
til dine3
f minutter3
dermed har3
nogen form3
settimeout thisrangesliderinitloanamount3
du vil3
bankly hvis3
lne uden3
500000 kr3
absolut billigste3
markedets absolut3
den billigste3
skal bruge3
billigste husln3
hurtigst muligt3
1 thisformrequestpaymenttime3
har et3
nyt ln3
windowga typeof3
typeof windowgagetall3
windowgagetall function3
flere ln3
har du3
if userdatarequestloanpurpose3
med et3
thisformutm source3
dermed kan3
new date3
ln og3
dig som3
axios method3
thisclicked true3
dig med3
submit thengtoken3
let sum3
sum 03
bruge bankly3
og god3
sammenlign nu3
og det3
sum itemamount3
thisconsolidationminamount sum3
else thisclicked3
dine tilbud3
thisbankmenucurrentitem 03
n ansgning3
index if3
thisformrequestpaymenttime 13
if windowga3
ansge om3
du blot3
null if3
settimeout thisrangesliderinitcarprice3
windowlocationhref thisapplicationpage3
thisclicked false3
if thisformrequestloanpurpose3
mange danskere3
fra andre3
thisformrequestloanpurpose samleln3
thisformrequestloanpurpose billn3
din bank3
thisformrequestloanamount thisloandefaultamount3
false thisformrequestconsolidateadditionalamount3
thisformrequestconsolidateadditionalamount 03
og hurtigt3
er et3
amount 03
op til3
positive false3
action submit3
som du3
nste gratis3
computedrate nste3
grecaptchaexecute6ldsvlqzaaaaala6jaggkeqjzykvmlrtuwz4qpr action3
bede om3
0 let3
hvad kan3
lavere rente3
thisformrequestpaymenttime 123
du vlger3
thisformrequestloanamount thisformrequestcarprice3
til din3
lender null3
adskillige banker3
du205
ln96
et89
og83
til78
er78
det73
if70
kan69
null56
052
false49
har47
p45
af37
hvis35
133
value33
med32
skal32
bankly32
din31
dig29
tilbud29
penge28
lne27
om27
nr26
ikke25
thisformtype24
else24
hos23
som23
fr23
der22
tage22
return22
den22
let21
fra21
vi20
thisformrequestcarprice20
nemlig20
blot19
eller19
s18
samleln18
thisformrequestdownpayment18
banker18
nsker18
thisformrequestloanamount18
dit17
217
sum17
dine17
billn16
derfor16
true16
flere16
bank16
index15
billigste15
thisformrequestconsolidateadditionalamount15
ansgning14
jeg14
314
hvad14
carloan14
ved13
da13
vil13
thisformrequestpaymenttime13
dette12
typisk12
bolig12
f12
pengene11
const11
rente11
meget11
bedste11
alts10
loan10
her10
uforpligtende10
form10
sammenlign10
samlet10
bruge10
ogs10
tid10
dermed10
op10
gld10
alle10
new10
lnetilbud10
sikkerhed9
lbetid9
vlg9
n9
hurtigt9
49
stedet9
thisformrequestloanpurpose9
dog9
konomi9
god9
type9
udbetaling9
59
vlge9
bil8
betale8
noget8
amount8
find8
ganske8
uden8
finde8
lnet8
gratis8
hvor8
nemt8
mere8
kun8
vre8
item8
tager8
formrequestpaymenttime8
muligt8
forbrugsln7
mange7
vores7
gerne7
kontant7
billigere7
nu7
thisformrequestconsolidatedebt7
bankerne7
styr7
br7
thisformrequestcaryear7
kr7
boligln7
r7
kbe7
windowlocationhref7
eksempelvis6
vigtigt6
66
billigt6
have6
event6
par6
bedre6
over6
thisformrequestconsolidateadditional6
positive6
res6
ud6
rate6
samlede6
kundeservice6
campingvogn6
thisstarted6
settimeout6
computeamountformrequestloanamount6
belb6
thisclicked6
selvflgelig6
ingen5
function5
potentielt5
altid5
disclaimerestablismentcost5
userdatarequestloanpurpose5
thisformleadapplicationid5
thisformutm5
disclaimeramounttorepay5
eksisterende5
disclaimertotalcostofloan5
var5
markedets5
anmeldelser5
disclaimercalculateyearly5
thisconsolidationminamount5
75
men5
thisbankmenucurrentitem5
modtaget5
udfylde5
errorcount5
samle5
sparer5
85
finansiere5
andelsboligln5
samme5
disse5
kunne5
consolidation5
thisformloanslength5
lender5
betaler5
nste5
mde5
newdata5
ind5
ansge5
ferie5
formtype5
forskellige5
ratecar5
hjlpe4
ydelse4
banken4
selv4
omk4
indtast4
ja4
end4
underskrive4
benytte4
lave4
etb4
mnedlig4
alt4
94
rejse4
fortrydelsesret4
indfrie4
kreditomkostninger4
debitorrente4
tilbagebetaling4
variabel4
hele4
andre4
gr4
mdr4
ny4
danskere4
kreditbelb4
nyt4
priseksempel4
dages4
computedrate4
spar4
thisform4
thisloandefaultamount4
indskuddet4
ssn4
source4
medium4
windowga4
thenresponse4
campaign4
denne4
pid4
husln4
transid4
t4
mc4
lastguess4
email4
rd4
gldfri4
lt4
thiscarloandownpaymentmaxamount4
itemamount4
hurtigst4
helt4
bd4
giver4
104
thisformloans4
bankln4
thiserrorconsolidateadditionalamount4
thisapplicationpage4
blog4
lner4
phone4
minutter4
114
budget4
--4
indtastet4
maj4
vlger4
registreret4
lavere4
sammenligne4
124
hvilket4
indfrielse4
kontantln4
thisconsolidationmaxamount4
privatkonomi4
kontakt4
thisformloansforeachitem4
masse4
134
efter4
mangler4
rigtig4
loanpurpose4
login4
set4
lnebelb4
se3
nogen3
nemmere3
langt3
gldsberegner3
isr3
absolut3
sjldent3
finansiering3
mske3
ansger3
passer3
derudover3
os3
krav3
timer3
adskillige3
spare3
stille3
anden3
kredit-ln3
deres3
indhente3
venligst3
localstorageremoveitemutm3
faktisk3
x3
thisrangesliderinitdownpayment3
thisbanksmenuclose3
thiserrorloanpurpose3
thisformapplicantssn3
thiserrorcaryear3
thisisvalidfieldthisformrequestcaryear3
thistempdownpayment3
guessrounds3
thisrangesliderinitloanamount3
lastres3
guess3
total3
token3
grecaptchaexecute6ldsvlqzaaaaala6jaggkeqjzykvmlrtuwz4qpr3
action3
submit3
thisrangesliderinitcarprice3
lastname3
gtoken3
forml3
143
ansg3
ret3
g3
videre3
hjere3
korrekt3
rki3
firstname3
finansielle3
data3
153
started3
163
173
applicant3
thengtoken3
typeof3
andet3
infobanklydk3
tilbudene3
enkelt3
ansgningen3
hurtig3
igennem3
renter3
nuvrende3
tilbuddene3
herefter3
bede3
betyder3
hvornr3
allerede3
indenfor3
tilbagebetalingstiden3
rette3
frste3
finder3
windowgagetall3
date3
thisformcreatedat3
183
193
userdatarequestdownpayment3
gclid3
atgd3
asclid3
axios3
responsedatagauserid3
method3
url3
thisisvalidfielditemtype3
thisisvalidcurrencyitemamount3
thisisvalidfielditemlender3
thisbankmenuselectedbanks3
thisformloansindexlender3
val3
del3

Who hosts Bankly.dk?

Bankly.dk Hosting Provider Information

Hosted IP Address:165.22.192.66
Hosted Hostname:165.22.192.66
Service Provider:Hewlett-Packard Company
Hosted Country:NetherlandsNL
Location Latitude:52.352
Location Longitude:4.9392
Webserver Software:nginx/1.17.3

Is "Hewlett-Packard Company" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
Hewlett-Packard Company
0.1360%

HTTP Header Analysis for Bankly.dk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.17.3
Date: Thu, 17 Jun 2021 12:31:50 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Link:; rel=shortlink
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Content-Encoding: gzip

Bankly.dk Domain Nameserver Information

HostIP AddressCountry
ns2.digitalocean.com 173.245.59.41
ns3.digitalocean.com 198.41.222.173
ns1.digitalocean.com 173.245.58.51


Need to find out who hosts Bankly.dk?


Domain Registration (WhoIs) information for Bankly.dk

 # Hello 116.203.74.96. Your session has been logged.
#
# Copyright (c) 2002 - 2021 by DK Hostmaster A/S
#
# Version: 4.0.2
#
# The data in the DK Whois database is provided by DK Hostmaster A/S
# for information purposes only, and to assist persons in obtaining
# information about or related to a domain name registration record.
# We do not guarantee its accuracy. We will reserve the right to remove
# access for entities abusing the data, without notice.
#
# Any use of this material to target advertising or similar activities
# are explicitly forbidden and will be prosecuted. DK Hostmaster A/S
# requests to be notified of any such activities or suspicions thereof.

Domain: bankly.dk
DNS: bankly.dk
Registered: 2016-10-28
Expires: 2023-10-31
Registration period: 5 years
VID: no
DNSSEC: Unsigned delegation, no records
Status: Active

Nameservers
Hostname: ns1.digitalocean.com
Hostname: ns2.digitalocean.com
Hostname: ns3.digitalocean.com

Websites with Similar Names

Recently Updated Websites

Gochina.pro (3 seconds ago.)Raleighbling.com (5 seconds ago.)Hxtzdb.net (7 seconds ago.)Aeroform3dacademy.com (8 seconds ago.)Globalagaitech.com (8 seconds ago.)Ovitapediatrics.com (9 seconds ago.)Biggestfailures.net (9 seconds ago.)Terrellrentals.com (9 seconds ago.)Territorioexea.com (10 seconds ago.)Themesforwindows8.org (10 seconds ago.)Hoffsemm.com (11 seconds ago.)Coswooster.com (12 seconds ago.)Zanzana.com (12 seconds ago.)Weplay.games (12 seconds ago.)Hockessincenterforchange.com (12 seconds ago.)Mingtiancrystal.com (13 seconds ago.)Detsoedehjem.dk (17 seconds ago.)Sandiary.com (17 seconds ago.)Benberger.org (18 seconds ago.)Makinghappyhouseholds.com (18 seconds ago.)Link5519.com (18 seconds ago.)Eprofessionalsportsbetting.com (19 seconds ago.)Buurcoaching.dk (19 seconds ago.)Youyou-mine.org (19 seconds ago.)Plurisense.org (20 seconds ago.)Start.jewelry (21 seconds ago.)Qdhjn.com (22 seconds ago.)Sportsmassage.org (22 seconds ago.)Protectorhealth.com (23 seconds ago.)Tematizandoquestoes.com (25 seconds ago.)

Recently Searched Keywords

gsm (2 seconds ago.)дозаторы непрерывного действия (5 seconds ago.)home and contact (5 seconds ago.)==> tham khảo địa chỉ của các đại lý của mực khô bá kiến tại  đây <== (5 seconds ago.)minimum orderhrefhreftargetfalsecolorffffffcurrencysymbolcurrencysymbolfirsttruepricefreeminimumorderprice50shopthemenameseo page (7 seconds ago.)beton.ng (8 seconds ago.)signikasans-serif color221b23 (8 seconds ago.)somme (3) (9 seconds ago.)mh group egypt (11 seconds ago.)data-csstve-u-174102add61 (11 seconds ago.)computer headsets (13 seconds ago.)youtube views (14 seconds ago.)extraordinary college (14 seconds ago.)swda (15 seconds ago.)brasa ovens (15 seconds ago.)art & craft (18 seconds ago.)mardin inşaat (19 seconds ago.)use-iconfill333sqs-slide-wrapperdata-slide-typecover-page (21 seconds ago.)fire insurance (22 seconds ago.)fr-barbecue.com (22 seconds ago.)fr-barbecue.com (22 seconds ago.)handjob (26 seconds ago.)fr-barbecue.com (26 seconds ago.)05left389pxgrid-area1 1 (27 seconds ago.)ocak başı (27 seconds ago.)sg-carousel (28 seconds ago.)data-csstve-u-17380bcf431 (28 seconds ago.)fr-barbecue.com (29 seconds ago.)name u043fu0440u043eu043cu044bu0448u043bu0435u043du043du043eu0435 (31 seconds ago.)gutierrez meaning (31 seconds ago.)