Bäst i test Guiden - Vi ger dig bäst i test vinnarna 2020

Safety: Low trust score
Year Founded: 2009
Global Traffic Rank: Unknown
Estimated Worth: $9

Bast-i-test.se ➤ Vill du veta vilka produkter som vunnit Bäst i test nyligen? Då har du kommit rätt! I våra guider kan du enkelt se bäst-i-test-vinnarna och få våra värdefulla tips inför ditt köp!



Domain summary

Last updated
2020-10-19
Domain label
bast-i-test
Domain extension
se
Domain registered:
2009-11-12
Domain updated:
2020-10-19
Domain expires:
2020-11-12
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is bast-i-test.se ranked relative to other sites:

Percentage of visits to bast-i-test.se from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Bast-i-test.se registered?
A: Bast-i-test.se was registered 11 years, 5 months, 6 days, 11 hours, 44 minutes, 22 seconds ago on Thursday, November 12, 2009.
Q: When was the WHOIS for Bast-i-test.se last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 2 days, 11 hours, 44 minutes, 22 seconds ago on Monday, October 19, 2020.
Q: What are Bast-i-test.se's nameservers?
A: DNS for Bast-i-test.se is provided by the following nameservers:
  • dina.ns.cloudflare.com
  • duke.ns.cloudflare.com
Q: Who is the registrar for the Bast-i-test.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Bast-i-test.se?
A: Bast-i-test.se has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Bast-i-test.se each day?
A: Bast-i-test.se receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Bast-i-test.se resolve to?
A: Bast-i-test.se resolves to the IPv4 address 104.18.39.42.
Q: In what country are Bast-i-test.se servers located in?
A: Bast-i-test.se has servers located in the United States.
Q: What webserver software does Bast-i-test.se use?
A: Bast-i-test.se is powered by CloudFlare webserver.
Q: Who hosts Bast-i-test.se?
A: Bast-i-test.se is hosted by CloudFlare, Inc. in United States.
Q: How much is Bast-i-test.se worth?
A: Bast-i-test.se has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Bast-i-test.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Bast-i-test.se Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Bast-i-test.se

H1 Headings

1 :
  1. Bäst i test Guiden

H2 Headings

1 :
  1. Bäst i test Guiden – Alla tester på en mänsklig sajt!

H3 Headings

15 :
  1. Luftvärmepump
  2. Lövblås
  3. Vinterdäck- dubb
  4. Friktionsdäck
  5. Padelracket
  6. Platt-TV
  7. Massagepistol
  8. Torktumlare
  9. Kylskåp / Kylfrys
  10. Diskmaskin
  11. Tvättmaskin
  12. Kaffebryggare
  13. Dagkräm
  14. Kompostkvarn
  15. Bäst i test Guidens ledord

H4 Headings

0 :

H5 Headings

2 :
  1. Bäst i test
  2. Tester inom:

H6 Headings

1 :
  1. Sidan är uppdaterad den 19 oktober 2020

Total IFRAMEs

0 :

Total Images

29 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-12526068-2

Links - Internal

234:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

2:

Keyword Cloud for Bast-i-test.se

vrahardetlsvadvitvarorkpakylskp kylfrysproduktertest guidenkroppsvrddammsugarekanmeddagkrmtest boschampfriktionsdckpngraabonnemangfrtvttmaskinmassagepistoldiskmaskintillattkylskphrlurarsplatttvdatorkylfryslvblsdenvihemsmarta hemvinterdck dubbpadelracketossbstatorktumlaredigbstdubbluftvrmepumpkompostkvarngaming0mestsmartvffeljrnnyhetsbrevrtrdgrdnugrbildckbst i testalladuguidenochboschvarsommardckkaffebryggaretestvi rsmartaavdatorersomvinterdcktesterom

Who hosts Bast-i-test.se?

Bast-i-test.se Hosting Provider Information

Hosted IP Address:104.18.39.42
Hosted Hostname:104.18.39.42
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
CloudFlare, Inc.
1.5273%

HTTP Header Analysis for Bast-i-test.se

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Mon, 19 Oct 2020 22:43:18 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Location: https://www.bast-i-test.se/
CF-Cache-Status: DYNAMIC
cf-request-id: 05e4a113aa0000dbf39e9e5000000001
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?lkg-colo=21&lkg-time=1603147398"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5e4e0465d9dcdbf3-LHR
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Bast-i-test.se Domain Nameserver Information

HostIP AddressCountry
dina.ns.cloudflare.com 108.162.192.107
duke.ns.cloudflare.com 173.245.59.110


Need to find out who hosts Bast-i-test.se?


Domain Registration (WhoIs) information for Bast-i-test.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: bast-i-test.se
holder: chrbst6797-00001
admin-c: eds0903-00002
tech-c: eds0903-00002
billing-c: eds0903-00001
created: 2009-11-12
modified: 2019-11-05
expires: 2020-11-12
transferred: 2019-10-03
nserver: dina.ns.cloudflare.com
nserver: duke.ns.cloudflare.com
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: EuroDNS S.A

Websites with Similar Names

Bast-ad.com
Bast-Ad | Advertising Platform
Bast-art.ru
Печать на холсте | Мастерская печати Баст, СПб
Bast-bau.de
Awesome Responsive Template
Bast-bbqschool.com
Hostnet: De grootste domeinnaam- en hostingprovider van Nederland.
Bast-clothing.com
Home - B.A.S.T. Be A Sweet Treasure
Bast-enterprises.de
Bast! Enterprises - Home page
Bast-film.ru
срок регистрации доменного имени bast-film.ru истек
Bast-food.com
Hostnet: De grootste domeinnaam- en hostingprovider van Nederland.

Recently Updated Websites

Tjpto.com (1 second ago.)Gagemybeautifulboy.com (1 second ago.)Solufitsa.com (2 seconds ago.)Woodlandsbutler.com (2 seconds ago.)Excelrem.com (2 seconds ago.)Kacsakgitsek.com (3 seconds ago.)Freemsa.com (3 seconds ago.)Karther.com (3 seconds ago.)Yourdnaportalforum.com (4 seconds ago.)E-czasopismo.pl (4 seconds ago.)Grindstonemindset.com (5 seconds ago.)Hoppsy.com (5 seconds ago.)Farmersdaughtersvirginia.com (5 seconds ago.)Doublensphotographyllc.com (5 seconds ago.)Oliphantbrands.com (5 seconds ago.)Michellesellstucson.net (5 seconds ago.)Publicinterest.ca (5 seconds ago.)Youbangxin.com (5 seconds ago.)Jaumebatlle.com (6 seconds ago.)Transandes.voyage (6 seconds ago.)Silverrose-hp.com (6 seconds ago.)Dowagiacnews.com (6 seconds ago.)Yourgrandparentrights.com (6 seconds ago.)Puzzelmakers.com (7 seconds ago.)Thegrowersfactory.com (7 seconds ago.)Athenabrand.com (7 seconds ago.)Txcorp.com (7 seconds ago.)Reimaginedwellness.com (8 seconds ago.)Ordernikispizzapasta.com (8 seconds ago.)R-d-c-l.com (8 seconds ago.)

Recently Searched Keywords

过程控制 (1 second ago.)zerocode (1 second ago.)브르넨삼성 (1 second ago.)social-icons-size-mediumsocial-icons-style-border (2 seconds ago.)hyperhidrosis treatment (3 seconds ago.)báo đời sống và hôn nhân – chàng kỹ sư kho cá cổ truyền giúp công ty thu về 5 tỷ (6 seconds ago.)buy a gift certificate (8 seconds ago.)foto lyd (8 seconds ago.)studio balans (9 seconds ago.)sets us (9 seconds ago.)snaautorental.com (10 seconds ago.)enquiries (11 seconds ago.)industriel (12 seconds ago.)почему после бани красные глаза (14 seconds ago.)ask panosu (15 seconds ago.)opinia (16 seconds ago.)st martin (17 seconds ago.)ржаное (18 seconds ago.)结婚流程 (20 seconds ago.)0190 60 opacity (21 seconds ago.)ga naar (22 seconds ago.)weil ein (23 seconds ago.)5 4 3 (25 seconds ago.)colgoni download (25 seconds ago.)mean (26 seconds ago.)9485 innovation campus way new albany oh (27 seconds ago.)báo đời sống và hôn nhân – chàng kỹ sư kho cá cổ truyền giúp công ty thu về 5 tỷ (30 seconds ago.)voluntari (31 seconds ago.)checkmarkafter (33 seconds ago.)componentnameparallax propsprops contextcontext (34 seconds ago.)