Bastelgrotte.de Favicon Bastelgrotte.de

Bastelgrotte.de Website Thumbnail
Checking...
Kali's Bastelgrotte – alles rund um meine Basteleien
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
bastelgrotte
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is bastelgrotte.de ranked relative to other sites:

Percentage of visits to bastelgrotte.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Bastelgrotte.de registered?
A: Bastelgrotte.de was registered 15 hours, 5 minutes, 6 seconds ago on Tuesday, October 27, 2020.
Q: When was the WHOIS for Bastelgrotte.de last updated?
A: The WHOIS entry was last updated 12 years, 1 month, 1 week, 3 days, 15 hours, 5 minutes, 6 seconds ago on Wednesday, September 17, 2008.
Q: What are Bastelgrotte.de's nameservers?
A: DNS for Bastelgrotte.de is provided by the following nameservers:
  • ns5.kasserver.com
  • ns6.kasserver.com
Q: Who is the registrar for the Bastelgrotte.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Bastelgrotte.de?
A: Bastelgrotte.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Bastelgrotte.de each day?
A: Bastelgrotte.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Bastelgrotte.de resolve to?
A: Bastelgrotte.de resolves to the IPv4 address 85.13.153.10.
Q: In what country are Bastelgrotte.de servers located in?
A: Bastelgrotte.de has servers located in the Germany.
Q: What webserver software does Bastelgrotte.de use?
A: Bastelgrotte.de is powered by Apache webserver.
Q: Who hosts Bastelgrotte.de?
A: Bastelgrotte.de is hosted by Neue Medien Muennich GmbH in Germany.
Q: How much is Bastelgrotte.de worth?
A: Bastelgrotte.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Bastelgrotte.de?

Bastelgrotte.de Hosting Provider Information

Hosted IP Address:85.13.153.10
Hosted Hostname:dd36204.kasserver.com
Service Provider:Neue Medien Muennich GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "Neue Medien Muennich GmbH" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Bastelgrotte.de

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 27 Oct 2020 09:54:39 GMT
Server: Apache
Location: https://bastelgrotte.de/
Content-Length: 232
Content-Type: text/html; charset=iso-8859-1

Bastelgrotte.de Domain Nameserver Information

HostIP AddressCountry
ns5.kasserver.com 85.13.128.3
ns6.kasserver.com 85.13.159.101


Need to find out who hosts Bastelgrotte.de?


WhoIs information for Bastelgrotte.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: bastelgrotte.de
Nserver: ns5.kasserver.com
Nserver: ns6.kasserver.com
Status: connect
Changed: 2008-09-17T17:10:20+02:00

Bastelgrotte.de Free SEO Report

Website Inpage Analysis for Bastelgrotte.de

H1 Headings

8 :
  1. Let’s Rock
  2. Gerade springt man noch…
  3. Medaillenhänger
  4. Steampunk Scrap
  5. gepimpte Pralinenschachtel
  6. Pedro
  7. Detlef
  8. Feenlicht

H2 Headings

24 :
  1. Kali's Bastelgrotte
  2. Kategorien
  3. Log-in
  4. 01.Challenge Montag
  5. 02. Challenge Montag 2 Wöchig
  6. 03.Challenge Dienstag
  7. 04.challenge Dienstag 2 Wöchig
  8. 05.Challenge Mittwoch
  9. 06.Challenge Mittwoch 2 Wöchig
  10. 07.Challenge Donnerstag
  11. 08.Challenge Donnerstag 2 Wöchig
  12. 09.Challenge Freitag
  13. 10.Challenge Freitag 2 Wöchig
  14. 11.Challenge Samstag
  15. 12.Challenge Samstag 2 Wöchig
  16. 13.Challenge Sonntag
  17. 14.Challenge Sonntag 2 Wöchig
  18. 15. Challenge Monatlich
  19. 16.Challenge alle 2 Wochen
  20. 17.sporadisch
  21. meine Lieblingslinks
  22. meine Familie
  23. Stempellaedle Designteam
  24. Blog Candy’s

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

18 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

76:
  1. Kali's Bastelgrotte
    https://bastelgrotte.de/
  2. Winner Badges
    https://bastelgrotte.de/?page_id=8280
  3. Winner Badge 2014
    https://bastelgrotte.de/?page_id=781
  4. Winner Badges 2015
    https://bastelgrotte.de/?page_id=1612
  5. Winner Badges 2016
    https://bastelgrotte.de/?page_id=4620
  6. Winner Badges 2017
    https://bastelgrotte.de/?page_id=7823
  7. Winner Badges 2018
    https://bastelgrotte.de/?page_id=10051
  8. Impressum
    https://bastelgrotte.de/?page_id=13
  9. Datenschutzerklärung
    https://bastelgrotte.de/?page_id=10470
  10. Datenauszug
    https://bastelgrotte.de/?page_id=10452
  11. Datenschutzeinstellungen Benutzer
    https://bastelgrotte.de/?page_id=10451
  12. Löschanfrage
    https://bastelgrotte.de/?page_id=10453
  13. 8
    https://bastelgrotte.de/?p=12097#comments
  14. Let’s Rock
    https://bastelgrotte.de/?p=12097
  15. AALL & Create
    https://bastelgrotte.de/?cat=129
  16. Karten
    https://bastelgrotte.de/?cat=22
  17. Stempel & Stanzen
    https://bastelgrotte.de/?cat=25
  18. No text
    https://bastelgrotte.de/?p=12097#comments

  19. https://bastelgrotte.de/?p=12097
  20. No text
    http://bastelgrotte.de/wp-content/uploads/2019/04/lets-rock.jpg
  21. 11
    https://bastelgrotte.de/?p=12055#comments
  22. Gerade springt man noch…
    https://bastelgrotte.de/?p=12055
  23. Stempelbar
    https://bastelgrotte.de/?cat=136
  24. Viva Las Vegas
    https://bastelgrotte.de/?cat=57
  25. No text
    https://bastelgrotte.de/?p=12055#comments

  26. https://bastelgrotte.de/?p=12055
  27. No text
    http://bastelgrotte.de/wp-content/uploads/2019/04/alt.jpg
  28. 2
    https://bastelgrotte.de/?p=12020#comments
  29. Medaillenhänger
    https://bastelgrotte.de/?p=12020
  30. Allgemein
    https://bastelgrotte.de/?cat=1
  31. gepimpt
    https://bastelgrotte.de/?cat=23
  32. No text
    https://bastelgrotte.de/?p=12020#comments

  33. https://bastelgrotte.de/?p=12020
  34. No text
    http://bastelgrotte.de/wp-content/uploads/2019/04/hanger.jpg
  35. No text
    http://bastelgrotte.de/wp-content/uploads/2019/04/hanger-ia.jpg
  36. No text
    http://bastelgrotte.de/wp-content/uploads/2019/04/hangr-ia2.jpg
  37. No text
    http://bastelgrotte.de/wp-content/uploads/2019/04/hanger-fertig.jpg
  38. 3
    https://bastelgrotte.de/?p=9150#comments
  39. Steampunk Scrap
    https://bastelgrotte.de/?p=9150
  40. Fantasia Festival 2017
    https://bastelgrotte.de/?cat=123
  41. Scrapbooking
    https://bastelgrotte.de/?cat=64
  42. No text
    https://bastelgrotte.de/?p=9150#comments

  43. https://bastelgrotte.de/?p=9150
  44. No text
    http://bastelgrotte.de/wp-content/uploads/2017/09/kali.jpg
  45. No text
    http://bastelgrotte.de/wp-content/uploads/2017/09/kali-close.jpg
  46. 1
    https://bastelgrotte.de/?p=11957#comments
  47. gepimpte Pralinenschachtel
    https://bastelgrotte.de/?p=11957
  48. Boxen Schachteln & Co
    https://bastelgrotte.de/?cat=55
  49. Gerda Steiner
    https://bastelgrotte.de/?cat=115
  50. Pralinenschachtel
    https://bastelgrotte.de/?cat=35
  51. No text
    https://bastelgrotte.de/?p=11957#comments

  52. https://bastelgrotte.de/?p=11957
  53. No text
    http://bastelgrotte.de/wp-content/uploads/2019/03/marion2.jpg
  54. No text
    http://bastelgrotte.de/wp-content/uploads/2019/03/marion3.jpg
  55. No text
    http://bastelgrotte.de/wp-content/uploads/2019/03/marion.jpg
  56. 5
    https://bastelgrotte.de/?p=11903#comments
  57. Pedro
    https://bastelgrotte.de/?p=11903
  58. Kritzelheldin
    https://bastelgrotte.de/?cat=135
  59. No text
    https://bastelgrotte.de/?p=11903#comments

  60. https://bastelgrotte.de/?p=11903
  61. No text
    http://bastelgrotte.de/wp-content/uploads/2019/02/pedro.jpg
  62. No text
    http://bastelgrotte.de/wp-content/uploads/2019/02/pedro2.jpg
  63. 4
    https://bastelgrotte.de/?p=11899#comments
  64. Detlef
    https://bastelgrotte.de/?p=11899
  65. No text
    https://bastelgrotte.de/?p=11899#comments

  66. https://bastelgrotte.de/?p=11899
  67. No text
    http://bastelgrotte.de/wp-content/uploads/2019/02/detlef.jpg
  68. No text
    http://bastelgrotte.de/wp-content/uploads/2019/02/detlef2.jpg
  69. Feenlicht
    https://bastelgrotte.de/?p=9286
  70. Feenlichter
    https://bastelgrotte.de/?cat=125

  71. https://bastelgrotte.de/?p=9286
  72. No text
    http://bastelgrotte.de/wp-content/uploads/2017/10/gabi.jpg
  73. « Older posts
    https://bastelgrotte.de/?paged=2
  74. « Apr
    https://bastelgrotte.de/?m=201904
  75. Anmelden
    http://bastelgrotte.de/wp-login.php
  76. Mehr Information
    https://bastelgrotte.de/?page_id=10438

Links - Internal (nofollow)

0:

Links - Outbound

172:
  1. Crafting from the Heart (Just for Fun)
    https://craftingfromtheheartchallengeblog.blogspot.com/
  2. Crafty Cardmakers (Mythical Creatures)
    http://craftycardmakers.blogspot.com/
  3. Through the Craft Room Door Magazine (Anything Goes)
    http://ttcrd.blogspot.com/
  4. Penny’s Paper Crafty Challenge (Anything Goes)
    http://pennyschallenges.blogspot.com/
  5. Simon Say Stamps (Anything Goes)
    https://www.simonsaysstampblog.com/wednesdaychallenge/
  6. Crafty Creation (Anything Goes)
    http://craftycreationschallenges.blogspot.com/
  7. Time Out Challenge (Playful)
    http://timeoutchallenges.blogspot.com/
  8. Colour Crazy Challenge (Anything Goes)
    https://colourcrazychallenge.blogspot.com/
  9. Crafty Catz (ATG)
    https://craftycatzweeklychallenge.blogspot.com/
  10. Creative Fingers Challenge (Anything Goes)
    http://creativefingerschallengeblog.blogspot.com/
  11. Creative Friday (für ein Mädchen/Frau)
    https://creativefriday.blogspot.com/
  12. Craftyhazelnut’s Patterned Paper (Anything Goes)
    http://craftyhazelnutspatternedpaper.blogspot.com/
  13. Dragonfly Dreams (Include an Animal)
    http://dragonflydreamschallenges.blogspot.com/
  14. A Bit More Time to Craft (Anything Goes)
    http://abitmoretimetocraft.blogspot.com/
  15. Make My Monday (Something Humerous)
    http://mmmchallengeblog.blogspot.com/
  16. Creadienstag (#375)
    https://www.creadienstag.de/
  17. Through the Craftroom Door Magazine (Anything Goes)
    http://ttcrd.blogspot.com/
  18. Papercraft Challenges (Polka Dots)
    https://papercraft-challenges.blogspot.com/
  19. Jo’s Scrap Shack (Anything Goes)
    http://www.josscrapshack.com/
  20. Creative Fingers (Anything Goes)
    http://creativefingerschallengeblog.blogspot.com/
  21. Scrapping 4 Fun Challenges (Anything Goes)
    http://scrapping4funchallenges.blogspot.com/
  22. Crafty Friends Challenge (Happy Birthday)
    http://craftyfriendschallengeblog.blogspot.com/
  23. The Corrosive Challenge (Anything Goes)
    http://corrosivechallengesbyjanet.blogspot.com/
  24. Crafty Creations (Anything Goes)
    http://craftycreationschallenges.blogspot.com/
  25. Simon Say Stamps (No Design Paper)
    https://www.simonsaysstampblog.com/wednesdaychallenge/
  26. Crafting from the Heart (Anything Goes)
    https://craftingfromtheheartchallengeblog.blogspot.com/
  27. Creadienstag (#374)
    https://www.creadienstag.de/
  28. Crafting with Friends (Anything Goes)
    https://crafting-with-friends.blogspot.com/
  29. Altered Eclectics (Anything Goes)
    http://alteredeclectics.blogspot.com/
  30. Artistic Inspiration (Just for Fun)
    https://artisticinspirationschallenges.blogspot.com/
  31. Kreativtanten (Alles geht)
    http://kreativtanten-challenge.blogspot.com/
  32. Crafty Friends Challenge (Ladies)
    http://craftyfriendschallengeblog.blogspot.com/
  33. SanDee & Amelie‘ Steampunk Challenge (Steampunk)
    https://sandee-and-amelie.blogspot.com/
  34. Your Scrapbook Place (Anything Goes)
    http://yourscrapbookplace.blogspot.com/
  35. The Crafters Cafe Challenge (Metal)
    https://crafterscafeblogchallenge.blogspot.com/
  36. Creadienstag(#372)
    https://www.creadienstag.de/
  37. Dream Valley Challenge (4 legged Friends)
    http://dreamvalleychallenges.blogspot.com/
  38. Crafting by Design (Anything Goes)
    https://craftingbydesigns.blogspot.com/
  39. Crafty Creations Challenge (Anything Goes)
    http://craftycreationschallenges.blogspot.com/
  40. Stempelküche (große Kleckse)
    http://stempelkueche-challenge.blogspot.com/
  41. Creative Friday (Alles was fliegt)
    https://creativefriday.blogspot.com/
  42. The Crafters Cafe Challenge Blog (Blue)
    https://crafterscafeblogchallenge.blogspot.com/
  43. Crafty Sentiments (Anything Goes)
    http://craftysentiments.blogspot.com/
  44. Creadienstag(#370)
    https://www.creadienstag.de/
  45. Papercraft Challenge (Clean and Simple)
    https://papercraft-challenges.blogspot.com/
  46. Everybody-Art-Challenge (Tiere)
    http://everybody-art-challenge.blogspot.com/
  47. Papercraft Challenge (All the Critters)
    https://papercraft-challenges.blogspot.com/
  48. The Paper Shelter (Things that fly)
    https://thepapershelter.blogspot.com/
  49. Aud Sentiments Challenge (Bingo+Sentiment)
    https://audsentimentschallengeblog.blogspot.com/
  50. Cupcake Inspiration (Add a Button)
    http://cupcakeinspirations.blogspot.com/
  51. Simon Say Stamps
    http://www.simonsaysstampblog.com/mondaychallenge/
  52. Bitten by the Bug
    http://heather-bittenbythebug2.blogspot.de/
  53. Crafting from the Heart
    http://craftingfromtheheartchallengeblog.blogspot.de/
  54. Crafty Cardmaker
    http://craftycardmakers.blogspot.de/
  55. Dream Valley
    http://dreamvalleychallenges.blogspot.com.au/
  56. Incy Wincy Design
    http://incywincydesigns.blogspot.de/
  57. Make My Monday
    http://mmmchallengeblog.blogspot.co.uk/
  58. stamps+fun=CREATIVITY
    http://stampsfun-creativity.blogspot.de/
  59. Crafty Sentiment
    http://craftysentiments.blogspot.de/
  60. CreaDienstag
    http://www.creadienstag.de/
  61. Die Cuttin Divas
    http://diecuttindivas.blogspot.de/
  62. Paper Minutes
    http://paperminutes.blogspot.de/
  63. Through the Craftroomdoor
    http://www.ttcrd.blogspot.com.au/
  64. (PIN)spirational
    http://pinspirationalchallenges.blogspot.ca/
  65. Cuttlebug Mania
    http://cuttlebugmania.blogspot.co.uk/
  66. Everybody Art Challenge
    http://everybody-art-challenge.blogspot.de/
  67. Ike's World Challenge
    http://ikesworldchallengeblog.blogspot.gr/
  68. Papercraft Challenge
    https://papercraft-challenges.blogspot.de/
  69. Shop your Stash
    http://shoppingourstash.blogspot.de/
  70. Crafting by Design
    http://craftingbydesigns.blogspot.de/
  71. Fab N Funky Challenge
    http://fabnfunkychallenges.blogspot.co.uk/
  72. Frilly and Funkie
    http://frillyandfunkie.blogspot.co.uk/
  73. Pennys Paper-Crafting Challenge
    http://pennyschallenges.blogspot.de/
  74. Simon Says Stamps
    http://www.simonsaysstampblog.com/wednesdaychallenge/
  75. Stampotique
    http://stampotiquedesignerschallenge.blogspot.de/
  76. The Paper Shelter
    http://thepapershelter.blogspot.de/
  77. Crafty Creations
    http://craftycreationschallenges.blogspot.de/
  78. Crafty Gals Corner
    http://craftygalscornerchallenges.blogspot.de/
  79. Creative Inspiration
    http://cinspirations.blogspot.de/
  80. Creative Moments
    http://carabbiemomentsofcraft.blogspot.co.uk/
  81. Cute N'Crafty Christmas
    https://cutencraftychristmas.blogspot.com/
  82. Double D Challenge
    http://daranddiane.blogspot.de/
  83. Scrapy Land
    http://www.scrapyland-blog.com/
  84. Stempelküche
    http://stempelkueche-challenge.blogspot.de/
  85. The crafty Addicts
    http://thecraftyaddicts.blogspot.de/
  86. Cute Card Thursday
    http://cutecardthursday.blogspot.de/
  87. Aud Sentiments Challenge
    http://audsentimentschallengeblog.blogspot.de/
  88. DL.Art
    http://dianamlarson.blogspot.de/
  89. Marianne Design
    http://mariannedesign.blogspot.de/
  90. Seize the Birthday
    http://seizethebirthday.blogspot.de/
  91. Time Out Challenge
    http://timeoutchallenges.blogspot.co.uk/
  92. Colouring Crazy
    http://colourcrazychallenge.blogspot.de/
  93. Crafty Catz Weekly
    http://craftycatzweeklychallenge.blogspot.de/
  94. Daring Cardmakers
    http://daringcardmakers.blogspot.de/
  95. Jo's Scrap Shack
    http://jwscrapshack.blogspot.ca/
  96. Alphabet Challenge
    http://alphabetchallengeblog.blogspot.de/
  97. Creative Fingers
    http://creativefingerschallengeblog.blogspot.de/
  98. Creative Friday
    http://creativefriday.blogspot.de/
  99. Kitty Bee Design
    http://alohafridaychallenges.blogspot.ca/
  100. Scrapping 4 Fun
    http://scrapping4funchallenges.blogspot.de/
  101. Winter Wonderland
    http://christmasblogchallenge.blogspot.de/
  102. Allsorts
    http://allsortschallenge.blogspot.de/
  103. Crazy 4 Challenges
    http://crazy4challenges.blogspot.de/
  104. Kraftin Kimmie
    http://kraftinkimmiestamps.blogspot.de/
  105. Stempeleinmaleins
    http://stempeleinmaleins.blogspot.de/
  106. Sweet Stampin
    http://sweetstampinchallengeblog.blogspot.de/
  107. Crafty Friends Challenge
    http://craftyfriendschallengeblog.blogspot.co.uk/
  108. My Time to Craft
    http://mytimetocraftchallenge.blogspot.de/
  109. Bawion
    http://bawion.blogspot.de/
  110. Cupcake Inspiration
    http://cupcakeinspirations.blogspot.de/
  111. Dragonfly Journey
    http://dragonflyjourneys.blogspot.de/
  112. Addicted to Stamp
    http://addicted-to-stamps-challenge.blogspot.de/
  113. Pile it On
    http://pileitonchallenge.blogspot.co.uk/
  114. Altered Eclectics
    http://alteredeclectics.blogspot.co.uk/
  115. Animal Friends
    http://animalfriendschallenge.blogspot.de/
  116. Artistic Inspiration Challenge
    http://artisticinspirationschallenges.blogspot.co.uk/
  117. Avenue613
    http://avenue613.blogspot.ca/
  118. Bastel Traum
    http://bastel-traum.blogspot.de/
  119. Brown Sugar Challenge
    http://brownsugarchallenge.blogspot.de/
  120. Christmas at Sweet Stamping
    http://christmasatsweetstampinchallengeblog.blogspot.co.uk/
  121. Classic Design Team
    https://classicdesignteamchallenge.blogspot.com/
  122. Craft-Dee Bowz
    http://craft-deebowz.blogspot.de/
  123. Crafting with Friends
    http://crafting-with-friends.blogspot.de/
  124. Crafty Calender
    http://craftycalendarchallenge.blogspot.de/
  125. Crafty Hazelnut
    http://craftyhazelnutspatternedpaper.blogspot.com/
  126. Cutie Pie
    http://cutiepiechallenge.blogspot.com.au/
  127. Dragonfly Dreams
    http://dragonflydreamschallenges.blogspot.com/
  128. Kreativ Tanten
    http://kreativtanten-challenge.blogspot.de/
  129. Love to Scrap
    http://lovetoscrapchallengeblog.blogspot.co.uk/
  130. Magnolia-licious Challenge
    http://magnolia-liciouschallengeblog.blogspot.de/
  131. Not Just Cards
    http://notjustcardschallenges.blogspot.de/
  132. Oddball Stamps Challenge
    http://oddballstamps.blogspot.de/
  133. Patties Creation
    http://pattiescreationschallenge.blogspot.de/
  134. Penny Black Saturday Challenge
    http://pennybfriendssaturdaychallenge.blogspot.de/
  135. SanDee & Amelies Steampunk Challenge
    http://sandee-and-amelie.blogspot.de/
  136. Simply Magnolia
    http://simplymagnolia.blogspot.de/
  137. Stamping Sensation
    http://sirstampalotchallenge.blogspot.de/
  138. The Corrosive Challenge
    http://corrosivechallengesbyjanet.blogspot.com/
  139. The Papernest Dolls
    http://thepapernestdollschallenge.blogspot.tw/
  140. Traumfabrik
    http://traumfabrik-challenge.blogspot.de/
  141. UnstampaBelles Challenge
    http://unstampabelleschallenges.blogspot.de/
  142. Your Scrapbook Place
    http://yourscrapbookplace.blogspot.com/
  143. A bit more Time to Craft
    http://abitmoretimetocraft.blogspot.de/
  144. Aurora Wings
    http://www.aurorawingschallenge.blogspot.de/
  145. Challenge up your Life
    http://challengeupyourlife.blogspot.de/
  146. Crafters Cafe Blog
    http://crafterscafeblogchallenge.blogspot.de/
  147. Dies R Us
    http://diesruschallenge.blogspot.de/
  148. MFT
    http://www.mftstamps.com/blog/
  149. Anja's Artefaktotum
    http://artefaktotum.blogspot.de/
  150. Bärbel Born
    http://www.baerbelborn.com/
  151. Bastelfrosch Anette
    http://bastelfrosch.blogspot.de/
  152. Gilas Handarbeiten
    http://gilashandarbeitenundbasteleien.blogspot.de/
  153. Lillife's Gruselkabinett
    http://lillifes-gruselkabinett.blogspot.de/
  154. Line's World
    http://lines--world.blogspot.de/
  155. Patty's Kreative Seite
    http://pattyskreativseite.blogspot.de/
  156. Stempeldani
    http://stempelschublade.blogspot.de/
  157. Stempelelfe JayJay
    http://stempelelfejayjay.blogspot.de/
  158. Sternensinn
    http://sternensinn.blogspot.de/
  159. Stine's Bastelkammer
    http://www.stines-bastelkammer.blogspot.de/
  160. Meine Cousine: Hüpfeball
    http://huepfeball.blogspot.de/
  161. Karina's Bastelparadies
    http://bastelparadiesappen.blogspot.de/
  162. Katja's kleine Welt
    http://www.katjas-kleine-welt.blogspot.de/
  163. Kersten
    http://kerstenskreativkiste.blogspot.de/
  164. KreativMANUfaktur
    http://kreativmanufaktur.blogspot.de/
  165. Petra's Art
    http://petrasart.blogspot.de/
  166. Sandra's Wolkentraum
    https://wolkentraum.wordpress.com/
  167. Selene
    http://kreatives-von-selene.blogspot.de/
  168. Sonja Traumfängerin
    http://traumfaengerinsseite.blogspot.de/
  169. Stempelkatzen Heike
    http://www.stempelkatzen.de/
  170. No text
    http://stines-bastelkammer.blogspot.de/2016/05/geburtstagscandy.html
  171. BuyNowShop.com
    http://BuyNowShop.com
  172. No text
    https://wp-dsgvo.eu

Links - Outbound (nofollow)

0:

Keyword Cloud for Bastelgrotte.de

seicrafty friendsamp stanzennichtcrafty creationsfridayist fr folgendehabekalietwaspapercraftmeisterschaftdragonflydsimon saynurjustcrafty creationnoch eincreadienstaggoes penny8217s paperpostedfr eine kollegindoor magazinekommthiercraftyfriends challengewochenendediesezupaperdannfolgende challenges craftingcraftersgoes penny8217sgoes creative fingersjainfinnajastempel ampmeinchallengesauchsimon say stampscreation anythingwinnerdochposted by kalisamstagmagazine anythingwardasmanwiefingersausgoes creativeeinepaper crafty challengeanything goeshabe ichgefllttrainingeuchwandheart anythingcrafty friends challengecraft anythinggoesfrcraftingdercorrosive challengefr euchmeinemagazine anything goesmorewinner badgestime to craftinfin heutepralinenschachtelheartcraft anything goesimmervielcrafty challenge anythingmrz 2019room door0aufampboxendenncreationspenny8217sdemboxen schachtelnfolgendeschachtelnshackeinich malhngerpaper craftymitfestivalgepimptemalscrap shackthroughzeitschachteln ampaprilesdensindstanzen infinchallenge anything goesschonmagazineanything goes penny8217sbadgessowirdzum bastelnscrappapercraft challengeboxen schachteln ampgehtdiesescraft roomdoor magazine anythingeine gepimptekolleginfriendsfolgende challengescreative fridaybitnochdie wandinfin heute habefertigcrafters cafefriends anythingchallenges craftingcreationcraft room doordesignstempelhoffeheute2019 in boxenbit more timecovongoes simonthrough the craftbeisimongutschatzihabe ich malheute habecrafting with friendsgeburtstaganything goes craftyhattebastelneine kolleginsteampunkcreative fingersgoes craftyhabheart anything goeszumtimegepimpte pralinenschachtelroom door magazinechallengestempel amp stanzencreative2diepenny8217s paper craftymrzwiramp stanzen infinich hoffegernenbspeineninspirationamp cocrafty creation anythingstampshngensentimentsfr einecafebit morechallenge anythingcrafty challengegscrappinganything goes creativebrettfr folgendeheute habe ichabermirsaygepimptwiedermycrazydoorgoes simon sayanything goes simonyourroomhabenistapril 2019say stampsmore timegleichblogschachteln amp cocraftfunnaja wiecreation anything goesnoch nichtfriends anything goesich nochhatstanzenist frfr folgende challengeswollte ichgoes crafty creationspenny8217s paperda1wei2 wchigcorrosive3ichallesanythingstanzen infin heuteweiterwolltemal wiederwchig

Longtail Keyword Density for Bastelgrotte.de

KeywordsOccurences
challenge anything goes10
posted by kali8
anything goes crafty8
time to craft7
fr folgende challenges7
bit more time6
craft anything goes5
stempel amp stanzen5
anything goes creative5
habe ich mal5
infin heute habe5
folgende challenges crafting5
heute habe ich5
boxen schachteln amp4
amp stanzen infin4
simon say stamps4
ist fr folgende4
magazine anything goes4
heart anything goes4
crafting with friends4
door magazine anything4
2019 in boxen3
crafty friends challenge3
goes crafty creations3
schachteln amp co3
friends anything goes3
goes creative fingers3
anything goes simon3
creation anything goes3
crafty creation anything3
goes simon say3
crafty challenge anything3
paper crafty challenge3
penny8217s paper crafty3
goes penny8217s paper3
anything goes penny8217s3
room door magazine3
craft room door3
through the craft3
stanzen infin heute3
fr eine kollegin3
anything goes43
habe ich10
challenge anything10
goes crafty8
2 wchig7
folgende challenges7
ich mal7
fr folgende7
stempel amp6
more time6
bit more6
craft anything5
goes creative5
creative fingers5
challenges crafting5
winner badges5
noch nicht5
amp stanzen5
infin heute5
heute habe5
say stamps4
heart anything4
ist fr4
stanzen infin4
fr euch4
gepimpte pralinenschachtel4
die wand4
schachteln amp4
boxen schachteln4
simon say4
magazine anything4
door magazine4
ich noch4
crafty creations4
zum basteln4
fr eine3
eine kollegin3
crafters cafe3
ich hoffe3
amp co3
eine gepimpte3
mrz 20193
friends anything3
papercraft challenge3
noch ein3
naja wie3
wollte ich3
corrosive challenge3
friends challenge3
crafty friends3
scrap shack3
craft room3
creative friday3
creation anything3
april 20193
mal wieder3
goes simon3
crafty challenge3
paper crafty3
penny8217s paper3
goes penny8217s3
room door3
crafty creation3
ich45
goes43
anything43
challenge41
die28
crafty23
das23
noch22
fr20
ist18
amp17
mal16
014
crafting12
es12
habe12
so11
challenges10
craft10
auch10
etwas10
eine10
ein10
creative10
meine9
friends9
time9
zum9
dem9
wir9
mit9
nicht9
da9
18
den8
infin8
kali8
dann8
posted8
nbsp8
schon8
paper8
design7
diese7
wchig7
wird7
scrap7
folgende7
zu7
euch7
stempel7
der7
heart6
more6
bit6
stamps6
wieder6
winner6
pralinenschachtel6
schachteln5
simon5
badges5
bei5
stanzen5
heute5
fingers5
aber5
wie5
blog5
through5
hier5
kollegin5
mein5
basteln5
25
sind5
naja5
inspiration5
schatzi5
gepimpte5
your4
steampunk4
papercraft4
gepimpt4
creations4
ja4
auf4
brett4
boxen4
wand4
crazy4
von4
alles4
creation4
wei4
zeit4
hab4
weiter4
mir4
fun4
einen4
geht4
door4
say4
magazine4
dieses4
denn3
mrz3
festival3
viel3
meisterschaft3
samstag3
fertig3
crafters3
cafe3
wochenende3
co3
gleich3
kommt3
gefllt3
hoffe3
man3
sentiments3
april3
d3
doch3
training3
hnger3
shack3
penny8217s3
friday3
dragonfly3
room3
33
haben3
wollte3
my3
creadienstag3
g3
scrapping3
nur3
geburtstag3
corrosive3
hat3
aus3
gerne3
sei3
hngen3
hatte3
gut3
war3
immer3
just3

Bastelgrotte.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Bastelgrotte.de is a scam?

Websites with Similar Names

Basteandgather.com
Paper Dahl – Curating a (mostly) handmade wardrobe
Bastech.com
Bastech Home | Bastech 3D Printing
Bastechinfo.com
BasTechInfo
Bastecklein.com
bastecklein's Wall - Ape Apps
Bastedegg.com
Basted Egg I Order On The Go I Breakfast in Aurora I Order Online
Bastedorealestate.com
Trevor Clark and Peter Bastedo – REMAX Real Estate Welcome Landing - Trevor Clark and Peter Bastedo - REMAX Real Estate
Basteen.com
Home Page

Recently Updated Websites

Gnu.zone 1 second ago.Rummut.fi 2 seconds ago.Yerkesmade.com 4 seconds ago.Holohancreatives.com 4 seconds ago.Nba48.com 4 seconds ago.Superfoodjunk.com 4 seconds ago.Photo360sports.com 4 seconds ago.Monarchlakes.net 5 seconds ago.Chungcumiennam.xyz 5 seconds ago.Barkstonedesigns.com 5 seconds ago.Annunciationami.org 5 seconds ago.Eztk.com 5 seconds ago.Auldreekieroofingedinburgh.com 6 seconds ago.Donaskakvetov.sk 8 seconds ago.Businessmantoday.us 9 seconds ago.Vlpmadisoncounty.com 9 seconds ago.Crispy-bird.com 10 seconds ago.Window-cleaning-supply.com 10 seconds ago.Cardiacstudycenter.com 11 seconds ago.Qjshs.net 12 seconds ago.Donburtonmedia.com 12 seconds ago.Farms.com 12 seconds ago.Nycrealtors.com 13 seconds ago.Sellcoralsprings.com 13 seconds ago.Customservicesint.com 13 seconds ago.Derm-hokudai.jp 13 seconds ago.Tuesdayswithdee.com 14 seconds ago.Flaapp.com 15 seconds ago.Ryanflettmedia.com 15 seconds ago.Lovemymuscles.com 15 seconds ago.