Bavoko.tools

Website Thumbnail
Checking...
All-in-One WordPress SEO Plugin | BAVOKO SEO Tools

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-30
Category: This site has not been categorized yet

2018 Release: BAVOKO SEO Tools brings together all aspects of search engine optimization in a single Wordpress plugin. Download BAVOKO SEO Tools for free!


Domain summary

Domain label
bavoko
Domain extension
tools
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is bavoko.tools ranked relative to other sites:

Percentage of visits to bavoko.tools from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Bavoko.tools registered?
A: Bavoko.tools was registered 4 weeks, 1 day, 13 hours, 48 minutes, 44 seconds ago on Friday, October 30, 2020.
Q: When was the WHOIS for Bavoko.tools last updated?
A: The WHOIS entry was last updated 4 weeks, 1 day, 13 hours, 48 minutes, 44 seconds ago on Friday, October 30, 2020.
Q: What are Bavoko.tools's nameservers?
A: DNS for Bavoko.tools is provided by the following nameservers:
  • val.ns.cloudflare.com
  • curt.ns.cloudflare.com
Q: Who is the registrar for the Bavoko.tools domain?
A: The domain has been registered at .
Q: What is the traffic rank for Bavoko.tools?
A: Bavoko.tools has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Bavoko.tools each day?
A: Bavoko.tools receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Bavoko.tools resolve to?
A: Bavoko.tools resolves to the IPv4 address 104.31.79.98.
Q: In what country are Bavoko.tools servers located in?
A: Bavoko.tools has servers located in the United States.
Q: What webserver software does Bavoko.tools use?
A: Bavoko.tools is powered by CloudFlare webserver.
Q: Who hosts Bavoko.tools?
A: Bavoko.tools is hosted by TOT Public Company Limited in United States.
Q: How much is Bavoko.tools worth?
A: Bavoko.tools has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Bavoko.tools Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Bavoko.tools Free SEO Report

Website Inpage Analysis for Bavoko.tools

H1 Headings

1 :
  1. Improve your SEO Workflow with the most powerful WordPress SEO Plugin

H2 Headings

11 :
  1. One WordPress Plugin for all SEO Tasks
  2. Detailed SEO Analysis
  3. Ranking Analysis & Keyword Research
  4. Detailed Onpage SEO Analysis
  5. Backlink Monitoring & Disavow Tool
  6. Pagespeed & Requests Analysis
  7. WordPress SEO Plugin with a powerful Toolset
  8. BAVOKO’s Content Optimizer
  9. More Data & Tools with BAVOKO SEO Tools PRO
  10. SEO Insights & Deals
  11. You have Successfully Subscribed!

H3 Headings

1 :
  1. Cookies

H4 Headings

6 :
  1. COMPREHENSIVE. EFFICIENT. SMART.
  2. Detailed SEO Analysis
  3. SEO Settings & Tools
  4. Content Optimization
  5. Extensive Data in the WordPress Backend
  6. BE A PRO!

H5 Headings

4 :
  1. Links
  2. Links
  3. Web Services
  4. BAVOKO

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

6 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

52:
  1. =d.offsetwidth&&0>=d.offsetheight)a=!1;else{c=d.getboundingclientrect();var+f=document.body;a=c.top+("pageyoffset"in+window?window.pageyoffset:(document.documentelement||f.parentnode||f).scrolltop);c=c.left+("pagexoffset"in+window?window.pagexoffset:(document.documentelement||f.parentnode||f).scrollleft);f=a.tostring()+","+c;b.b.hasownproperty(f)?a=!1:(b.b[f]=!0,a=a<=b.e.height&&c<=b.e.width)}a&&(b.a.push(e),b.d[e]=!0)};p.prototype.checkimageforcriticality=function(b){b.getboundingclientrect&&q(this,b)};h("pagespeed.criticalimages.checkimageforcriticality",function(b){n.checkimageforcriticality(b)});h("pagespeed.criticalimages.checkcriticalimages",function(){r(n)});var+r=function(b){b.b={};for(var+d=["img","input"],a=[],c=0;c=a.length+e.length&&(a+=e)}b.g&&(e="&rd="+encodeuricomponent(json.stringify(s())),131072>=a.length+e.length&&(a+=e),d=!0);t=a;if(d){c=b.f;b=b.h;var+f;if(window.xmlhttprequest)f=new+xmlhttprequest;else+if(window.activexobject)try{f=new+activexobject("msxml2.xmlhttp")}catch(k){try{f=new+activexobject("microsoft.xmlhttp")}catch(u){}}f&&(f.open("post",c+(-1==c.indexof("?")?"?":"&")+"url="+encodeuricomponent(b)),f.setrequestheader("content-type","application/x-www-form-urlencoded"),f.send(a))}}},s=function(){var+b={},d=document.getelementsbytagname("img");if(0==d.length)return{};var+a=d[0];if(!("naturalwidth"in+a&&"naturalheight"in+a))return{};for(var+c=0;a=d[c];++c){var+e=a.getattribute("pagespeed_url_hash");e&&(!(e+in+b)&&0=b[e].k&&a.height>=b[e].j)&&(b[e]={rw:a.width,rh:a.height,ow:a.naturalwidth,oh:a.naturalheight})}return+b},t="";h("pagespeed.criticalimages.getbeacondata",function(){return+t});h("pagespeed.criticalimages.run",function(b,d,a,c,e,f){var+k=new+p(b,d,a,e,f);n=k;c&&m(function(){window.settimeout(function(){r(k)},0)})});})();pagespeed.criticalimages.run('/mod_pagespeed_beacon','www.bavoko.tools/','yddryu7ik1',true,false,'6yvxy--v-ku'); //]]>">Bavoko //=d.offsetWidth&&0>=d.offsetHeight)a=!1;else{c=d.getBoundingClientRect();var f=document.body;a=c.top+("pageYOffset"in window?window.pageYOffset:(document.documentElement||f.parentNode||f).scrollTop);c=c.left+("pageXOffset"in window?window.pageXOffset:(document.documentElement||f.parentNode||f).scrollLeft);f=a.toString()+","+c;b.b.hasOwnProperty(f)?a=!1:(b.b[f]=!0,a=a<=b.e.height&&c<=b.e.width)}a&&(b.a.push(e),b.d[e]=!0)};p.prototype.checkImageForCriticality=function(b){b.getBoundingClientRect&&q(this,b)};h("pagespeed.CriticalImages.checkImageForCriticality",function(b){n.checkImageForCriticality(b)});h("pagespeed.CriticalImages.checkCriticalImages",function(){r(n)});var r=function(b){b.b={};for(var d=["IMG","INPUT"],a=[],c=0;c=a.length+e.length&&(a+=e)}b.g&&(e="&rd="+encodeURIComponent(JSON.stringify(s())),131072>=a.length+e.length&&(a+=e),d=!0);t=a;if(d){c=b.f;b=b.h;var f;if(window.XMLHttpRequest)f=new XMLHttpRequest;else if(window.ActiveXObject)try{f=new ActiveXObject("Msxml2.XMLHTTP")}catch(k){try{f=new ActiveXObject("Microsoft.XMLHTTP")}catch(u){}}f&&(f.open("POST",c+(-1==c.indexOf("?")?"?":"&")+"url="+encodeURIComponent(b)),f.setRequestHeader("Content-Type","application/x-www-form-urlencoded"),f.send(a))}}},s=function(){var b={},d=document.getElementsByTagName("IMG");if(0==d.length)return{};var a=d[0];if(!("naturalWidth"in a&&"naturalHeight"in a))return{};for(var c=0;a=d[c];++c){var e=a.getAttribute("pagespeed_url_hash");e&&(!(e in b)&&0=b[e].k&&a.height>=b[e].j)&&(b[e]={rw:a.width,rh:a.height,ow:a.naturalWidth,oh:a.naturalHeight})}return b},t="";h("pagespeed.CriticalImages.getBeaconData",function(){return t});h("pagespeed.CriticalImages.Run",function(b,d,a,c,e,f){var k=new p(b,d,a,e,f);n=k;c&&m(function(){window.setTimeout(function(){r(k)},0)})});})();pagespeed.CriticalImages.Run('/mod_pagespeed_beacon','www.bavoko.tools/','YddRYU7ik1',true,false,'6YVXY--V-KU'); //]]>
    https://www.bavoko.tools/
  2. Bavoko Home
    https://www.bavoko.tools/
  3. Bavoko Content Optimizer
    https://www.bavoko.tools/content-optimization/
  4. Bavoko Search
    https://www.bavoko.tools/seo-ranking-analysis/
  5. Bavoko Onpage
    https://www.bavoko.tools/onpage-seo/
  6. Bavoko Backlinks
    https://www.bavoko.tools/backlinks-wp/
  7. Bavoko Performance
    https://www.bavoko.tools/wp-performance/
  8. Bavoko SEO Tools
    https://www.bavoko.tools/wp-seo-tools/
  9. Bavoko Pricing
    https://www.bavoko.tools/pricing/
  10. Bavoko Knowledge Base
    https://www.bavoko.tools/knowledge_base/
  11. Bavoko Services
    https://www.bavoko.tools/services/
  12. Bavoko English
    https://www.bavoko.tools/
  13. Bavoko Deutsch
    https://www.bavoko.tools/de/
  14. Bavoko More about Search
    https://www.bavoko.tools/seo-ranking-analysis/
  15. Bavoko More about Onpage
    https://www.bavoko.tools/onpage-seo/
  16. Bavoko More about Backlinks
    https://www.bavoko.tools/backlinks-wp/
  17. Bavoko More about Performance
    https://www.bavoko.tools/wp-performance/
  18. Bavoko More about SEO Tools
    https://www.bavoko.tools/wp-seo-tools/
  19. Bavoko More about Content Optimizer
    https://www.bavoko.tools/content-optimization/
  20. Bavoko View Pricing
    https://www.bavoko.tools/pricing/
  21. Bavoko Installation & Setup of BAVOKO SEO Tools
    https://www.bavoko.tools/knowledge_base/installation-and-setup/
  22. Bavoko Plugin Architecture - BAVOKO SEO Tools explained test
    https://www.bavoko.tools/knowledge_base/bst-wp-seo-plugin-tutorial/
  23. Bavoko Importing Data from previous SEO Plugins
    https://www.bavoko.tools/knowledge_base/import-data-from-your-previous-wordpress-seo-plugins/
  24. Bavoko Data in BAVOKO SEO Tools – Privacy & Control
    https://www.bavoko.tools/knowledge_base/data-sets-memory-control/
  25. Bavoko Content Optimization Tools and Analysis in WordPress
    https://www.bavoko.tools/knowledge_base/content-optimization-tool-wp/
  26. Bavoko Finding, Adding & Analyzing SEO Keywords in WordPress
    https://www.bavoko.tools/knowledge_base/seo-keywords-wordpress/
  27. Bavoko SEO Keyword Research in BAVOKO SEO Tools PRO
    https://www.bavoko.tools/knowledge_base/seo-keyword-research-in-bavoko-seo-tools-pro/
  28. Bavoko SEO Keyword Monitoring Tool for WordPress
    https://www.bavoko.tools/knowledge_base/seo-keyword-monitoring-wp/
  29. Bavoko Google Keyword Rankings – SEO Analysis in BAVOKO SEO Tools
    https://www.bavoko.tools/knowledge_base/seo-keyword-ranking-analysis-wp/
  30. Bavoko Editing the robots.txt file in WordPress
    https://www.bavoko.tools/knowledge_base/robots-txt-wp-plugin/
  31. Bavoko Permalink Settings and automatic URL redirects
    https://www.bavoko.tools/knowledge_base/permalink-seo-settings-wordpress-plugin/
  32. Bavoko Editing the .htaccess file in WordPress
    https://www.bavoko.tools/knowledge_base/wp-htaccess-plugin-2/
  33. Bavoko Creating & submitting a Sitemap in WordPress
    https://www.bavoko.tools/knowledge_base/wordpress-sitemaps/
  34. Bavoko Creating 301 & 302 Redirects in WordPress
    https://www.bavoko.tools/knowledge_base/wordpress-redirects/
  35. Bavoko Creation & Optimization of Meta Titles and Descriptions in WordPress
    https://www.bavoko.tools/knowledge_base/meta-descriptions-titles-wordpress/
  36. Bavoko Onpage SEO Audit in WordPress – Website Analysis & Optimization
    https://www.bavoko.tools/knowledge_base/onpage-seo-audit-wordpress/
  37. Bavoko Marking & submitting Spam Domains using the Disavow Tool
    https://www.bavoko.tools/knowledge_base/spam-domains-wordpress-2/
  38. Bavoko Backlink Monitoring – Analysis in WordPress
    https://www.bavoko.tools/knowledge_base/backlink-monitoring-analysis-in-wordpress/
  39. Bavoko Analyzing HTTP Requests for Pagespeed Optimization in WordPress
    https://www.bavoko.tools/knowledge_base/http-requests-wordpress-2/
  40. Bavoko Pagespeed Analysis in WordPress
    https://www.bavoko.tools/knowledge_base/wp-pagespeed-analysis-plugin/
  41. Bavoko Blog
    https://www.bavoko.tools/blog/
  42. Bavoko Press
    https://www.bavoko.tools/press/
  43. Bavoko Contact & Support
    https://www.bavoko.tools/contact/
  44. Bavoko Affiliate Program
    https://www.bavoko.tools/affiliate-program/
  45. Bavoko WordPress SEO Plugin Comparison
    https://www.bavoko.tools/wordpress-seo-plugins-comparison/
  46. Bavoko Benefits of PRO
    https://www.bavoko.tools/pro/
  47. Bavoko Web Design, Web Development & SEO
    https://www.bavoko.tools/services/
  48. Bavoko WordPress Agency
    https://www.bavoko.tools/services/wordpress-agency-berlin/
  49. Bavoko WordPress Plugin Development
    https://www.bavoko.tools/services/wordpress-plugin-developer/
  50. Bavoko Imprint
    https://www.bavoko.tools/imprint/
  51. Bavoko Privacy Policy
    https://www.bavoko.tools/privacy-policy/
  52. Bavoko Find out more.
    https://www.bavoko.tools/privacy-policy/

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Bavoko.tools

seo toolsmostimportantpostgoogleallcanourcontent optimizervarprovides youwithin038descriptionsseobavoko seopagesrankingsfewinsidetimesthroughapi0filesitemapampkeywordplugintoolsearchextensiveresearchkeywordsyouonpageinsightswellwordpress seobavokocomprehensiveseo pluginprovidesoutyourduringdataexternalseo settingscontentbavoko seo toolswordpressrequestssettingsoptimizationoptimizermetapowerfuldisavowrankingtoolsanalysiscrawlerpriorityyou canhaveredirectstitlessinglemoremonitoringperformance

Who hosts Bavoko.tools?

Bavoko.tools Hosting Provider Information

Hosted IP Address:104.31.79.98
Hosted Hostname:104.31.79.98
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "TOT Public Company Limited" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Bavoko.tools

Http-Version: 1.1
Status-Code: 302
Status: 302 Found
Date: Fri, 30 Oct 2020 11:25:06 GMT
Content-Type: text/html; charset=iso-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: SAMEORIGIN
Location: https://bavoko.tools/
CF-Cache-Status: DYNAMIC
cf-request-id: 061ada1df400000847429c1000000001
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=GMVIoGTHnUOjFkMj3dVwpqh1xsV38lyjI0M4W5HlGk/0OGBgdAg9Ub+BhhEXFWOyUAwJV0qwO39sxIm59MYMMxCI/EhqqcVjDmYAh9I="}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5ea4c60fee640847-CDG

Bavoko.tools Domain Nameserver Information

HostIP AddressCountry
val.ns.cloudflare.com 173.245.58.234
curt.ns.cloudflare.com 173.245.59.94


Need to find out who hosts Bavoko.tools?


Domain Registration (WhoIs) information for Bavoko.tools

 Domain Name: bavoko.tools
Registry Domain ID: 1b09b2a3aea8414eb99cdb0ed930a75a-DONUTS
Registrar WHOIS Server: whois.psi-usa.info
Registrar URL: http://www.psi-usa.info
Updated Date: 2020-01-17T17:59:39Z
Creation Date: 2018-01-17T17:58:55Z
Registry Expiry Date: 2021-01-17T17:58:55Z
Registrar: PSI-USA, Inc. dba Domain Robot
Registrar IANA ID: 151
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: autoRenewPeriod https://icann.org/epp#autoRenewPeriod
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization:
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: DE
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: DE
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: val.ns.cloudflare.com
Name Server: curt.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-02-21T04:20:30Z

Websites with Similar Names

Bavok.site
bavok.site | 520: Web server is returning an unknown error
Bavokala.ir
مشاوره حقوقی 24 ساعته مشاوره حقوقی با وکیل - مشاوره حقوقی 24 ساعته مشاوره حقوقی 24 ساعته با وکیل
Bavoko.com
OM'MAG - Online Medien Magazin | Web, Media & Marketing
Bavoko.tools
All-in-One WordPress SEO Plugin | BAVOKO SEO Tools

Recently Updated Websites

Ehimemarathon.jp 2 seconds ago.Dsnsky.com 3 seconds ago.Heritageskateboards.com 4 seconds ago.Social-apteka.ru 9 seconds ago.Myturntotravel.com 11 seconds ago.Waysfocus.com 12 seconds ago.Kehilatsinai.org 16 seconds ago.Empiremusiconline.com 17 seconds ago.Ulusbant.com 18 seconds ago.Naughtyneedletattoo.com 18 seconds ago.Thesidelines.com 21 seconds ago.Rocksaltgrille.com 26 seconds ago.Rgtav.com 27 seconds ago.Tvoivolosy.com 30 seconds ago.Mujerderelaxentuciudad.club 30 seconds ago.Tranvantoan.com 31 seconds ago.Centerlex.ph 31 seconds ago.Pkmt.ru 33 seconds ago.Redcross.kn 33 seconds ago.Leggendeoscure.com 33 seconds ago.Uasinsights.com 35 seconds ago.Stephaneicher.com 36 seconds ago.Btkittydo.ws 37 seconds ago.Sunhome-co.com 39 seconds ago.Steinkreis.net 39 seconds ago.Queen-hair.com 45 seconds ago.Ntsqatar.com 46 seconds ago.Blackstarsurfshop.com 48 seconds ago.Wxxinzhidian.com 51 seconds ago.Ankhcomunicacion.com 52 seconds ago.