Bbci.co.uk  |  BBC - Homepage
Low trust score  | 
Explore the BBC, for latest news, sport and weather, TV & radio schedules and highlights, with nature, food, comedy, children's programmes and much more




Bbci.co.uk Website Information

Website Ranks & Scores for Bbci.co.uk

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:18,938
Majestic Rank Majestic Rank:7,712
Domain Authority Domain Authority:70%
DMOZ DMOZ Listing:No

Whois information for bbci.co.uk

Full Whois Lookup for Bbci.co.uk Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Bbci.co.uk. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain name:
bbci.co.uk

Registrant:
British Broadcasting Corporation

Registrant type:
UK Corporation by Royal Charter

Registrant's address:
Broadcasting House
Portland Place
London
W1A 1AA
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 06-May-2016

Registrar:
British Broadcasting Corporation [Tag = BBC]
URL: http://www.bbc.co.uk

Relevant dates:
Registered on: 02-Apr-2000
Expiry date: 02-Apr-2024
Last updated: 08-Jun-2015

Registration status:
Registered until expiry date.

Name servers:
ns3.bbc.co.uk 156.154.66.17 2610:a1:1015::17
ns3.bbc.net.uk
ns4.bbc.co.uk 156.154.67.17 2001:502:4612::17
ns4.bbc.net.uk

WHOIS lookup made at 21:36:57 20-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Bbci.co.uk?

Bbci.co.uk is hosted by BBC in England, London, United Kingdom, Ec4n.
Bbci.co.uk has an IP Address of 212.58.244.129 and a hostname of bbc-vip152.telhc.bbc.co.uk.



Bbci.co.uk Web Server Information

Hosted IP Address:212.58.244.129
Hosted Hostname:bbc-vip152.telhc.bbc.co.uk
Service Provider:BBC
Hosted Country:United KingdomGB
Location Latitude:51.5092
Location Longitude:-0.0955
Webserver Software:Not Applicable

HTTP Header Analysis for Bbci.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
Content-Type: text/html
Content-Language: en-GB
Etag: "35e1b93bb42c3f82c7b83928633f8d5a"
X-PAL-Host: pal055.back.live.cwwtf.local:80
Transfer-Encoding: chunked
Date: Sun, 14 Jun 2015 10:05:01 GMT
Connection: keep-alive
X-Cache-Action: HIT
X-Cache-Hits: 1851
X-Cache-Age: 88
Cache-Control: private, max-age=0, must-revalidate
Vary: X-CDN


Need to find out who hosts Bbci.co.uk?

Bbci.co.uk Free SEO Report

Website Inpage Analysis for Bbci.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Bbci.co.uk

swifttravelwildtimegetsmeanepisodelongringeddieleaguemobehind2currentpositiongetcurrentpositionmouthwateringbuy mygettingpremierdermot hasliverpool2 milliontop tipsdohad 120 gaswoman0otherdegreebarcelonaforsythwhichcell hadbritainsagedretainbarker steveoffuspaintinghaswatchvonewalkslive saturday session7pilgrimwe1had 120carolinemadridmore thanmakedaughtersessionbest1 episodeampitsyourerichard osman caroline15 episodetakinghelptrack race4 episode 120 augustfilmwilly russell shirley4 episodemetfinal trackweektogetheruniversity employeecell had 120worldboyemployeecharacterclubmayweatherbutwindowbbciso1ctatypeiplayervideotextscreenwatchvisit120 gasnowadultspeoplejohnnowreaderlistenhadpagelengthcaroline barker steveyoudiespridecomedian jerryuniversityoverosman caroline barkertaylorjust do4sara coxiplayerusehaverefuses6baghdadsirloveplaceterror cellstates retaincraig charlesrunningnew comedyministerpremier leaguedies agedattacksfoodstevejerryauguststeve buncefunctiontoppartfeeltestupdatesbabiesfirsticeepisode 1ctatypeiplayervideotextscreenwatchlikespanishgasusingvarrusselldaysthey1 part3willy russellfindinternetmuchsays5somebarkerrealcarlisleideasrisottobritainx27syour childepisode 1subtitleseriesshirleyjustukus amptrycoxnewfinal track racedidscrollgrowingchargedriseuppoliceplaymarkcouldstateslive saturdaysarauk adultsnewsterrorbbc radioexplainoutdoorradiohousemirandaprime ministerquizsolheimosman1ctatypeiplayervideotextscreenwatch nowreaderwatchmostwins final tracktolkienitemsagainst1seriesseriescellfinalseeallunderbackbandhomeeducatingterror cell hadcraig charles housedressafterhomepagebuncewins finaloutcomedian jerry lewistheseosman carolinerichard osmanincludingmillionbuyrecipesnowreaderwatchhisif1subtitleseries 1makingepisode 1comediansprimeunitedyourlewisrussell educatingcomedyrichardorbfigsummerknowtwostillliveusedaroundcomedianmysaturdaylostgamecaroline barkerradio 5fansbeenrussell shirleymcgregorholidaydancefarahbreakfastshows8dermotwantedsaturday sessionflavourbrucecupdownchanningdecidehas a livegothingscharlessimpletalkswestepisode 1ctatypeiplayervideotextscreenwatch nowreaderwatchfind outwinsthroughlast1subtitleserieseasyyearsfunsolarcraigthanreturnbarker steve buncetheirtownchildracev5bruce forsythjerry lewisflockinglittletipstrackcharles housemiranda metwanted to buywantfootballnowreaderlisten on iplayerourpromswe knowcanwillybbcfamilyherforgottenmoremoyet

Longtail Keyword Density for Bbci.co.uk

KeywordsOccurences
nowreaderlisten on iplayer6
osman caroline barker6
has a live6
live saturday session6
final track race5
craig charles house4
cell had 1204
barker steve bunce4
terror cell had4
had 120 gas4
caroline barker steve4
richard osman caroline3
episode 1ctatypeiplayer-videotextscreenwatch nowreaderwatch3
comedian jerry lewis3
wins final track3
wanted to buy3
4 episode 13
willy russell shirley3
premier league9
osman caroline6
saturday session6
caroline barker6
1 episode6
live saturday6
bbc radio5
final track5
track race5
1ctatypeiplayer-videotextscreenwatch nowreaderwatch4
russell educating4
barker steve4
charles house4
craig charles4
20 august4
russell shirley4
your child4
more than4
dermot has4
had 1204
just do4
120 gas4
miranda met4
states retain4
terror cell4
cell had4
steve bunce4
episode 13
1subtitleseries 13
willy russell3
richard osman3
4 episode3
episode 1ctatypeiplayer-videotextscreenwatch3
episode 1subtitleseries3
buy my3
prime minister3
sara cox3
find out3
wins final3
us amp3
comedian jerry3
jerry lewis3
dies aged3
uk adults3
radio 53
we know3
university employee3
1 part3
top tips3
bruce forsyth3
new comedy3
2 million3
15 episode3
bbc37
radio30
windowbbciso24
iplayer23
you20
your19
has19
her16
do15
their14
function14
after14
we13
episode12
league12
more12
his12
uk12
012
new11
var11
out11
if11
world10
long9
live9
premier9
some9
race9
most9
things8
can8
saturday8
town8
russell8
part7
tips7
million7
find7
child7
attacks7
just7
17
session7
fans7
house7
make7
quiz7
two6
love6
real6
taylor6
my6
forgotten6
now6
back6
us6
than6
best6
they6
people6
nowreaderwatch6
charles6
nowreaderlisten6
had6
barker6
caroline6
osman6
1seriesseries6
one6
home6
wins6
film5
which5
little5
much5
know5
pagelength5
decide5
top5
up5
shows5
years5
see5
our5
lost5
these5
university5
last5
comedian5
states5
first5
test5
lewis5
go5
used5
final5
track5
mo5
try5
amp5
august4
but4
simple4
1ctatypeiplayer-videotextscreenwatch4
terror4
aged4
time4
craig4
summer4
wild4
1subtitleseries4
met4
24
ideas4
running4
34
band4
behind4
west4
against4
over4
retain4
miranda4
gets4
character4
have4
solheim4
barcelona4
44
didscroll4
sara4
sir4
including4
comedy4
cell4
talks4
around4
boy4
liverpool4
help4
youre4
football4
eddie4
gas4
breakfast4
through4
shirley4
making4
educating4
news4
v4
dermot4
ring4
steve4
play4
bunce4
easy3
like3
baghdad3
police3
club3
dress3
use3
travel3
flavour3
food3
mouthwatering3
week3
53
spanish3
mcgregor3
willy3
tolkien3
watch3
solar3
richard3
mayweather3
v53
currentposition3
getcurrentposition3
orbfig3
63
ice3
daughter3
buy3
wanted3
pilgrim3
refuses3
mark3
days3
charged3
employee3
flocking3
under3
73
internet3
its3
off3
moyet3
swift3
been3
walks3
cup3
recipes3
feel3
risotto3
game3
united3
proms3
madrid3
updates3
other3
growing3
homepage3
mean3
john3
could3
carlisle3
cox3
using3
britains3
want3
britainx27s3
return3
says3
83
adults3
bruce3
forsyth3
dance3
channing3
painting3
comedians3
outdoor3
fun3
together3
holiday3
getting3
dies3
family3
items3
down3
still3
taking3
rise3
visit3
all3
woman3
degree3
minister3
prime3
babies3
farah3
explain3
place3
pride3
jerry3

What are the nameservers for bbci.co.uk?

Bbci.co.uk Domain Nameserver Information

HostIP AddressCountry
ns3.bbc.co.uk 156.154.66.17United States United States
ns3.bbc.net.uk 156.154.64.17United States United States
ns4.bbc.co.uk 156.154.67.17United States United States
ns4.bbc.net.uk 156.154.65.17United States United States

Bbci.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Bbci.co.uk is a scam?