BERHALTER Swiss Die-Cutting - The Number One in Die-Cutting

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Meet the Experts. BERHALTER Swiss Die-Cutting is the world's leading manufacturer of die-cutting machines and die-cutting tools.



Domain summary

Last updated
2021-11-30
Domain label
berhalter
Domain extension
red
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Berhalter.red registered?
A: Berhalter.red was registered 1 month, 3 weeks, 3 days, 7 hours, 52 minutes, 1 second ago on Tuesday, November 30, 2021.
Q: When was the WHOIS for Berhalter.red last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 3 days, 7 hours, 52 minutes, 1 second ago on Tuesday, November 30, 2021.
Q: What are Berhalter.red's nameservers?
A: DNS for Berhalter.red is provided by the following nameservers:
  • ns1.cyon.ch
  • ns2.cyon.ch
Q: Who is the registrar for the Berhalter.red domain?
A: The domain has been registered at .
Q: What is the traffic rank for Berhalter.red?
A: Berhalter.red has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Berhalter.red each day?
A: Berhalter.red receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Berhalter.red resolve to?
A: Berhalter.red resolves to the IPv4 address 149.126.4.42.
Q: In what country are Berhalter.red servers located in?
A: Berhalter.red has servers located in the Switzerland.
Q: What webserver software does Berhalter.red use?
A: Berhalter.red is powered by webserver.
Q: Who hosts Berhalter.red?
A: Berhalter.red is hosted by Cyon GmbH in Switzerland.
Q: How much is Berhalter.red worth?
A: Berhalter.red has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Berhalter.red Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Berhalter.red Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Berhalter.red

H1 Headings

1 :
  1. Keep up-to-date. Subscribe to the Newsletter.

H2 Headings

8 :
  1. CUTnology™ Die Cutting Systems
  2. BEAMstack™ Packaging Robotics
  3. CUTcontrol™ Digitalization
  4. INNOVATIONby die-cutting
  5. Markets
  6. Experts Blog
  7. Brands
  8. The Number One in Die-Cutting

H3 Headings

0 :

H4 Headings

9 :
  1. Most people wish good health for their future. As a megatrend, it shapes all areas of life – as do nutrition and packaging solutions.
  2. Need food for thought? Find out what moves experts in the industry and what the professional world thinks about current topics and the latest trends.
  3. 7 Steps to the right Embossing
  4. 6 Important Questions when Selecting a Die-Cutting Tool
  5. We are proud that our products are used for numerous brand owners. Our passion is to create unique brand experiences and trigger buying impulses.
  6. Our passion is to support die-cutting companies, print shops and food manufacturers to automate and optimise the processes of their die-cutting systems. Our die-cutting machines, die-cutting tools and innovations are consistently designed for efficiency and a long service life.
  7. Die-Cutting Solution
  8. Digitalization
  9. Datenschutz

H5 Headings

9 :
  1. Food
  2. Beverages
  3. Pet Care
  4. Pharma
  5. Non-Food
  6. Prok. Karl de Zordo, Head of Production, Vice President
  7. Bruce Hoerr, General Manager - Die Cut Lidding
  8. Sara García Moya, Directora proyectos
  9. Lieven Vuye, General Manager

H6 Headings

4 :
  1. Markets
  2. Our Mission
  3. About us
  4. Get in touch

Total IFRAMEs

0 :

Total Images

43 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-174926101-1

Links - Internal

61:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Berhalter.red

htmldivproductionask nowfooditscookies diehtmldivinnerhtml htmldivcssmore askenabletruehavehtmldivinnerhtmlwehasperformance038canvarsiemore ask nowvar htmldivsindelseerr errcookiesinnovativelearn more askyourpartnerder websitedie cutliddingyouswissmoresystemsnowwebsiteberhalter aguniquebeencuttingswiss dieagyou canmachinederdiecuttingcutsupportcompanyourerrexpertsdietouchtoolsberhalterlearn morepackaging solutionstheirgoodcutcontrolhtmldivcsssolutionshas beendiese cookieslearnwerdenaskpackagingdiesegeneralsustainability

Who hosts Berhalter.red?

Berhalter.red Hosting Provider Information

Hosted IP Address:149.126.4.42
Hosted Hostname:s033.cyon.net
Service Provider:Cyon GmbH
Hosted Country:SwitzerlandCH
Location Latitude:47.1449
Location Longitude:8.1551
Webserver Software:Not Applicable

Is "Cyon GmbH" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
Cyon GmbH
0.0077%

HTTP Header Analysis for Berhalter.red

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
Content-Type: text/html; charset=UTF-8
X-Pingback: https://www.berhalter.red/xmlrpc.php
Link:; rel=shortlink
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Tue, 30 Nov 2021 03:31:25 GMT
Alt-Svc: quic=":443"; ma=2592000; v="43,46", h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-25=":443"; ma=2592000, h3-27=":443"; ma=2592000

Berhalter.red Domain Nameserver Information

HostIP AddressCountry
ns1.cyon.ch 194.126.200.5
ns2.cyon.ch 91.206.24.2


Need to find out who hosts Berhalter.red?


Domain Registration (WhoIs) information for Berhalter.red

 Domain Name: berhalter.red
Registry Domain ID: d314f7f5f0cd4a18b599b9883cc63ef7-DONUTS
Registrar WHOIS Server: whois.rrpproxy.net
Registrar URL: http://key-systems.net
Updated Date: 2021-02-14T22:23:28Z
Creation Date: 2020-02-13T22:40:16Z
Registry Expiry Date: 2022-02-13T22:40:16Z
Registrar: Key-Systems, LLC
Registrar IANA ID: 1345
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.68949396850
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Berhalter AG
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province:
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: CH
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns1.cyon.ch
Name Server: ns2.cyon.ch
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-11-30T03:31:29Z

Websites with Similar Names

Recently Updated Websites

Sunnysdrealty.com (6 seconds ago.)Kizrelax.com (7 seconds ago.)Rosinlasik.com (11 seconds ago.)Caphila.com (14 seconds ago.)Rudhraindia.com (15 seconds ago.)Asiapacifictradecouncil.org (15 seconds ago.)Rebldindustries.com (20 seconds ago.)Changethespace.com (22 seconds ago.)Mtolakewood.com (23 seconds ago.)Irlmbs.com (31 seconds ago.)Smoothjazz.eu (33 seconds ago.)Alcyone.org.uk (38 seconds ago.)Onlinejapanfes.com (38 seconds ago.)Sinmaekspres.com (39 seconds ago.)Cac-ichikawa.com (40 seconds ago.)Mehmettombul.com (41 seconds ago.)Centaur365.vip (43 seconds ago.)Hdorgasm.com (44 seconds ago.)Aboutdetail.com (48 seconds ago.)Kiamayoga.com (48 seconds ago.)Fentanyeuropa.com (50 seconds ago.)Sachiconstructionmw.com (51 seconds ago.)Deepskinaesthetics.com (53 seconds ago.)Gzydzssj.com (54 seconds ago.)D4tagirl.com (56 seconds ago.)Pocmdcny.com (1 minute 1 second ago.)Minkdbyming.com (1 minute 3 seconds ago.)Suprabhatjkss.com (1 minute 5 seconds ago.)Sunglasseshats.com (1 minute 5 seconds ago.)Lebrun-jf-maconnerie.fr (1 minute 5 seconds ago.)

Recently Searched Keywords

reproduktiv (1 second ago.)function pixflowshortcodeanimation iftypeof (1 second ago.)gossip lanka news fb photos (1 second ago.)forreal kitchen (3 seconds ago.)desfurat (4 seconds ago.)content-bg-onnotclassic-layout-listnotcentered-layout-listnotgradient-overlap-layout-listnotgradient-overlay-layout-listnotcontent-rollover-layout-list (4 seconds ago.)terastation (5 seconds ago.)background-colorrgba61 (5 seconds ago.)cikampek purwakarta cianjur (6 seconds ago.)rent falcon city (7 seconds ago.)16 годовщина церкви (7 seconds ago.)page for more (8 seconds ago.)chaussettes (10 seconds ago.)historial de pedidos (10 seconds ago.)importantes (11 seconds ago.)codehi5u (11 seconds ago.)electric scooter vs electric bike reddit (12 seconds ago.)loans 24 hours (13 seconds ago.)important button-88590 (14 seconds ago.)pic (16 seconds ago.)windowbamsgfbpageid (16 seconds ago.)dt img (16 seconds ago.)piano tavolo in legno di rovere (16 seconds ago.)divyigxxtfmllsidebar mo-optin-form-note font-size (17 seconds ago.)loves you 7 (17 seconds ago.)artropatia degenerativa acromioclavicular incipiente (17 seconds ago.)nissan cars (18 seconds ago.)casa grande (20 seconds ago.)������������������ ��������������, ���������� (lossless) (20 seconds ago.)feel then (20 seconds ago.)