Berkshirehathawayhs.com Website Information

Website Ranks & Scores for Berkshirehathawayhs.com

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:107,340
Majestic Rank Majestic Rank:132,972
Domain Authority Domain Authority:60%
DMOZ DMOZ Listing:No

Whois information for berkshirehathawayhs.com

Full Whois Lookup for Berkshirehathawayhs.com Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Berkshirehathawayhs.com. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: BERKSHIREHATHAWAYHS.COM
Registry Domain ID: 1730003607_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-06-28T16:10:37Z
Creation Date: 2012-06-27T16:05:01Z
Registry Expiry Date: 2018-06-27T16:05:01Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.FNISTOOLS.COM
Name Server: NS2.FNISTOOLS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-18T06:40:48Z

Who hosts Berkshirehathawayhs.com?

Berkshirehathawayhs.com is hosted by Real Estate Digital LLC in United States.
Berkshirehathawayhs.com has an IP Address of 208.93.240.77 and a hostname of fidelitymlssolutions.com.



Berkshirehathawayhs.com Web Server Information

Hosted IP Address:208.93.240.77
Hosted Hostname:fidelitymlssolutions.com
Service Provider:Real Estate Digital LLC
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable
Google Map of 50,12

Websites Hosted on Same IP (i.e. 208.93.240.77)

Homepage | Long Island and Queens Realtor Ken Kader | MLSLI.com -...
- newhydeparkhouses.com

Find homes for sale, find an agent, view virtual tours, receive homes by e-mail, learn about buying and selling a home and more!

  Not Applicable   $ 8.95

Colorado Real Estate | Homes for Sale in Colorado | RE/MAX Alliance
- homesincolorado.com

Search homes for sale in Colorado including Denver, Boulder, Fort Collins, & Mountain Suburbs. Colorado Real Estate brought to you by RE/MAX Alliance

  943,865   $ 960.00

PARMLS | Pensacola
- pensacolamls.com

Find homes for sale, find an agent, view virtual tours, receive homes by e-mail, learn about buying and selling a home and more!

  678,031   $ 1,440.00

Homes for Sale | Real Estate Listings | Realtor Search | McColly...
- mccolly.com

Find a real estate agent or homes for sale at mccolly.com. Research a community and get detailed school reports. Find property in Indiana and Illinois. We're local, we're global.

  322,306   $ 21,600.00

Austin real estate | Homes for Sale Austin | Austin Homes | Austin...
- austinhomesearch.com

Welcome to AustinHomeSearch, the official Austin real estate search brought to you by the Austin Board of REALTORS. Find Austin homes for sale or lease, learn about Austin home...

  220,387   $ 31,320.00

HTTP Header Analysis for Berkshirehathawayhs.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Language: en
Date: Mon, 20 Jun 2016 21:21:12 GMT
Connection: Keep-Alive
Content-Length: 21741
Vary: Accept-Encoding
Content-Encoding: gzip


Need to find out who hosts Berkshirehathawayhs.com?

Berkshirehathawayhs.com Free SEO Report

Website Inpage Analysis for Berkshirehathawayhs.com

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Berkshirehathawayhs.com

itembuynull3realreturnsellelse ifinputnamecriterialocationkcneighborhoodif popupcountaccessurltimestatecodeextraparamscurrentlocaleiduscountrylangtrimcenterimagesdollareachyouhaveluxuryexpires expirydatetoutcstringshowtypeberkshire hathawaylocalservicesinputcleartitlelabelberkshire hathaway homeservicesextraparams typekeycodetypeajax type getpath expires expirydatetoutcstringexpiresajax1citydataif kchathaway homeservicesdatatypeaffiliatespath expiresberkshireextraparams type extraparamstypehomesthisaddclassactivepathsearchingmsghtmlreferrerurl documentlocationhrefexpirydatetoutcstringofficesknowreal estatedata functionivar countryourdatatype jsondocumentcookiepeso4formatitemthisvalpostjsonblockagentajax typefunctionstates datainamefinddesbuttonimageclickthandatainame elseoneestatehathawaymorefalsehomeservicesstateagentsentertype extraparamstypegetthisval referrerurl documentlocationhrefeventkeycodesuccess functiondatayourpostredirecturlnonestatesnewdocumentlocationhrefelsechinesesuccesstype gethomeifget urllocationpagecountry datainameeventsigneziphome pagestatesweextraparamstypechecklocationtypetryvalueseereturn falselanguagesdataistatecodenameeach data functionifunctionieach datainputtitlelabelsearchpleasesubmiterrorwe knowthisval referrerurlsubmittingcurrentunitselectkeytype get urlinformationfunctiondatalocbannermsgcssdisplaylistingtruevar statesreferrerurlnewsuccess functiondata varpropertiesrctdatainamethem2addressfunctiondata var0locationtypepopupcountvarformyour hometrim var

Longtail Keyword Density for Berkshirehathawayhs.com

KeywordsOccurences
type get url6
ajax type get6
extraparams type extraparamstype4
each data functioni4
success functiondata var3
path expires expirydatetoutcstring3
thisval referrerurl documentlocationhref3
berkshire hathaway homeservices3
else if6
get url6
ajax type6
type get6
success functiondata5
var country4
each data4
referrerurl documentlocationhref4
data functioni4
functiondata var4
berkshire hathaway4
return false4
datainame else4
states datainame4
we know4
country datainame4
type extraparamstype4
extraparams type4
trim var3
real estate3
datatype json3
var states3
your home3
expires expirydatetoutcstring3
home page3
if popupcount3
if kc3
path expires3
thisval referrerurl3
hathaway homeservices3
var65
if63
function31
else18
return17
data17
url16
type15
015
get15
false14
country14
dollar13
112
home12
city10
more10
state10
states10
zip9
datainame9
null8
kc8
address8
know8
your8
true8
popupcount8
us7
you7
peso7
value7
functiondata7
item6
we6
location6
ajax6
new6
datatype6
success6
page5
25
agents5
try5
statecode5
extraparamstype5
error5
submitting5
extraparams5
35
45
key5
thisaddclassactive5
event4
search4
each4
please4
inputtitlelabel4
json4
functioni4
sell4
postredirecturl4
referrerurl4
documentlocationhref4
thisval4
eventkeycode4
path4
real4
block4
currentlocaleid4
form4
e4
agent4
trim4
our4
local4
homes4
statesnew4
luxury4
berkshire4
loc-banner-msgcssdisplay4
hathaway4
homeservices4
affiliates3
properties3
them3
see3
information3
than3
find3
access3
listing3
keycode3
lang3
dataistatecode3
des3
neighborhood3
enter3
estate3
checklocationtype3
buy3
expirydatetoutcstring3
services3
time3
sign3
offices3
expires3
documentcookie3
none3
chinese3
post3
submit3
currentunit3
centerimages3
languages3
locationtype3
rc3
searching-msghtml3
formatitem3
buttonimageclick3
name3
inputcleartitlelabel3
have3
t3
one3
select3
inputnamecriterialocation3
showtype3

What are the nameservers for berkshirehathawayhs.com?

Berkshirehathawayhs.com Domain Nameserver Information

HostIP AddressCountry
ns1.fnistools.com 208.93.240.69United States United States
ns2.fnistools.com 208.93.240.70United States United States

Berkshirehathawayhs.com DNS Record Analysis DNS Lookup

HostTypeTTLExtra
berkshirehathawayhs.comA3579IP: 208.93.240.77
berkshirehathawayhs.comNS300Target: ns1.fnistools.com
berkshirehathawayhs.comNS300Target: ns2.fnistools.com
berkshirehathawayhs.comSOA300MNAME: ns1.fnistools.com
RNAME: dnsadmin.fnistools.com
Serial: 2013091830
Refresh: 1200
Retry: 600
Expire: 2419200
berkshirehathawayhs.comMX300Target: berkshirehathawayhs-com.mail.protection.outlook.com
berkshirehathawayhs.comTXT300TXT: v=spf1
include:spf.protection.outlook.com -all
berkshirehathawayhs.comTXT300TXT: MS=ms93547739

Alexa Traffic Rank for Berkshirehathawayhs.com


Alexa Search Engine Traffic for Berkshirehathawayhs.com