Home | Berlin Direkt Versicherung

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-28

Berlin Direkt Versicherung, Ihr Experte für Reiseversicherung und Haftpflichtversicherung!


Domain summary

Domain label
berlin-direktversicherung
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is berlin-direktversicherung.de ranked relative to other sites:

Percentage of visits to berlin-direktversicherung.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Berlin-direktversicherung.de registered?
A: Berlin-direktversicherung.de was registered 4 months, 4 days, 1 hour, 8 minutes, 30 seconds ago on Wednesday, October 28, 2020.
Q: When was the WHOIS for Berlin-direktversicherung.de last updated?
A: The WHOIS entry was last updated 2 years, 8 months, 1 week, 6 days, 1 hour, 8 minutes, 30 seconds ago on Monday, June 18, 2018.
Q: What are Berlin-direktversicherung.de's nameservers?
A: DNS for Berlin-direktversicherung.de is provided by the following nameservers:
  • ns1.brandshelter.com
  • ns2.brandshelter.de
  • ns3.brandshelter.info
  • ns4.brandshelter.net
  • ns5.brandshelter.us
Q: Who is the registrar for the Berlin-direktversicherung.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Berlin-direktversicherung.de?
A: Berlin-direktversicherung.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Berlin-direktversicherung.de each day?
A: Berlin-direktversicherung.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Berlin-direktversicherung.de resolve to?
A: Berlin-direktversicherung.de resolves to the IPv4 address 134.119.241.143.
Q: In what country are Berlin-direktversicherung.de servers located in?
A: Berlin-direktversicherung.de has servers located in the Germany.
Q: What webserver software does Berlin-direktversicherung.de use?
A: Berlin-direktversicherung.de is powered by Apache webserver.
Q: Who hosts Berlin-direktversicherung.de?
A: Berlin-direktversicherung.de is hosted by domainfactory GmbH in North Rhine-westphalia, Germany.
Q: How much is Berlin-direktversicherung.de worth?
A: Berlin-direktversicherung.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Berlin-direktversicherung.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Berlin-direktversicherung.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Berlin-direktversicherung.de

H1 Headings

3 :
  1. Reiseversicherung - im Paket
  2. Auslandskrankenversicherung
  3. Reiserücktrittsversicherung

H2 Headings

6 :
  1. Fahrrad und E-Bike-Versicherung
  2. Zahnzusatzversicherung
  3. Privathaftpflichtversicherung
  4. Reiserücktrittsversicherung
  5. Reiseversicherung im Paket
  6. Auslandskrankenversicherung

H3 Headings

0 :

H4 Headings

9 :
  1. Kostenfreie Beratung
  2. Produktfinder
  3. Service
  4. Reiseversicherung
  5. Cyberversicherung
  6. Fahrrad und E-Bike
  7. Haftpflichtversicherung
  8. Zahnzusatzversicherung
  9. Service & Kontakt

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

9 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

37:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Berlin-direktversicherung.de

price3val angepasst elseresulttarif resulthtmlpaar familiepercentelse ifprice3val 500priceinfohtml elsefalseschaden meldenprice3val4000 searchform3 priceinfohtmlihrresulthtmlpaar familie elseboxprice3elementreturncomparedatevar mm 0mmmitclearintervalbarintervalresulthtmlpaarproductdetailname3valreisercktritt basisresulthtmleinzelperson elseboxprice11 productname1valjahresreiseschutz4return false validclasspaketein fehlertrue onchangedateinarrayvalue paraminputreisezielcheckedvalresultalterajax type getitem3htmljahre abboxprice2 resultalterreiseende2valalertnix gefundenpaarifprice1val 10000ddformatdateadddaysmindate 365successifmm 10caseswitch14ismobile10000 price3val10000 searchform3form return falsevar dd 0ddifmaxheight 0 autoheightheightmaxheightddalter bistrue submithandlerproductdetailname1tofixed2replacepricehtmlespriceinfohtml else ifprice3val1errorclass invalid invalidhandlerproductname3valjahresreisercktrittschutz basis plus65 jahreboxprice2searchform2 inputlaufzeitvaluejahrescheckedval64000 searchform3getprice3attrdisableddisabledvar yydgetfullyearunser kundenservice schnellinvalidhandlerreiseversicherungfahrrad30ifsearchform1androidwebosiphoneipadipodblackberryitestnavigatoruseragenttableuserinformationshow boxprice1tarif einzelperson paarangepasst else ifpriceval22paar familiereturn thisoptionalelementautoheighteachfunctioneboxprice2 tableuserinformationshowabfalse ifismobilethisheight iftypeofh undefinedheaderform103boxprice3 tableuserinformationshow boxprice3zahlweiseif searchform2 inputlaufzeitvalueeinmalcheckedvalist ein fehlertodayhighlight true onchangedateelsemaxheight maxheight hformmindate newauf den nchsth5showden nchst mglichenifprice3val 2000 price3valboxprice2 tableuserinformationhide boxprice2sum221else ifsearchform1aufgetretenbitte versuchen260mm varunserboxprice2 tableuserinformationshow boxprice2invalidelse ifproductname3valjahresreisercktrittschutz basisifprice3val 2000 searchform3ist ein8usa u cankundenserviceproductdetailname1valjahresreiseschutz premium ifsearchform1ihr beitrag tarifsum2 responsepriceprice3val 40000 autoheighteachfunctionebeforesendtableuserinformationhidenew dateselecteddatevalueofifhvar maxheightreisepreis wurde aufelse if searchform2inputversicherungsnehmervalue1checkedvalinklhonce0d calendarweeksrulesihryydgetfullyear varifpricevalplusinputaltervalue2removeattrdisabledreisepreis wurdeeinmalig else11melden10 var191000 price3valmaxifprice3val 1000resulthtmltableuserinformationshow boxprice2validclassiftypeofh undefineddenfalse validclass successstartdate mindate enddatetableuserinformationshow boxprice30 autoheightheightmaxheightelse ifprice3val 30001000 searchform3h thisheight iftypeofhrequired truebeitragdddgetdateifsearchform3 inputlaufzeitvaluejahrescheckedvalprice3rulesadd required trueautoclose true0mm var yydgetfullyearerrorclassperproductname1valjahresreiseschutz premium23else ifprice1valinputaltervalue1clickzahlweisetext monatlich elseignoresubmithandler1000 price3val1000 searchform3calendarweeksdatatype json beforesendvar mindateproductname0dprice3val10000 searchform3 priceinfohtmlihr1000 searchform3 priceinfohtmlproductdetailname3valjahresreisercktritt basis10 var ddvariantsnchst mglichengetprice2attrdisabledboxprice2 resulttarifgetprice2attrdisabled disabledprice3val1000json beforesend functioneinzelperson paar0mmproductdetailname3valjahresreisercktritt basis plusreisebeginn3val4000 searchform3 priceinfohtml5000 price3val5000 searchform3ignore rules2000 searchform3plus ifsearchform3 inputlaufzeitvaluejahrescheckedvalcalendarweeks true autocloseprice3val2000 searchform3 priceinfohtmlihrautoheighteachfunctione h thisheightmonthlyresulttarif resulthtmlprice3val4000 searchform3kontaktcccifdd 10 var33searchform3 inputversicherungsnehmervalue1checkedval searchform3basis plus ifsearchform3var startdatefehler reisepreis submithandleraufgetretenbittereisepreismonthly zahlweisetext monatlichfehler selbstbeteiligungfehler aufgetretenbitte versuchenvar dddgetdateformatschnellboxprice1 tableuserinformationshow boxprice1alertnix gefunden returnwpcontentpluginshmrvapisearchphp data productnameangepasst else5000 price3val5000else ifprice3val32true falsedebugddmmyyyy languagezahlweisetext jhrlichsearchform3 inputversicherungsnehmervalue2checkedvalcase 224per mailinputversicherungsnehmervalue1checkedval searchform3boxprice3 resulttariffunction formtitlehidebreak case 2ajax typepricehtmlifzahlweise2valohne sbifprice3val 3000searchform3 price3val searchform3dd 0dd varresultreiseziel resulthtmlweltweit13inputaltercheckedvalbisdebug true submithandlerdatatype jsonbasis plusinputlaufzeitvalueeinmalcheckedvalerneut berechnenmindatefehlerwpcontentpluginshmrvapisearchphp datazahlweisetext jhrlich elsetrue max 5000fehler versicherungsnehmerunsangepasst else ifprice3val0dd var mmdgetmonth1androidwebosiphoneipadipodblackberryitestnavigatoruseragent trueselected var mindatevalidclass successtype getvalidatoraddmethodequalsnew dateselecteddatevalueof vartszahlweisetext var sum2dddgetdate ifdd 10h ifmaxheight 0informierenstartdate mindatemglichen staffelpreis price1valstaffelpreis price3valinputversicherungsnehmervalue2checkedvalwirbeitrag berechnen jquerydocumentreadyfunctionthisheightelse ifprice3val 4000mmdgetmonth1 ifmm 10true false ifismobilevar dnewprice3val2000language de startdateaufgetretenbitte versuchen sievalidclass success errorclassautoclose true todayhighlight18true maxvar mmdgetmonth1 ifmmangepasstdd 0ddismobile androidwebosiphoneipadipodblackberryitestnavigatoruseragentnumber trueformatdateadddaysmindate 45inkl usaifdd 10ifsearchform3 inputlaufzeitvalueeinmalcheckedval searchform3var winstaffelpreisifprice3val 6000pricehtmles ist einmindate new dateselecteddatevalueofinputselbstbeteiligungcheckedvaltarifvarianten1val 1 productname1valjahresreiseschutzplus ifsearchform3tableuserinformationshowjhrlichiftypeofhelse ifprice3val 8000resultselbstbeteiligungvar sum2thisoptionalelement inarrayvalueifismobile var15validateformthis comparedateinputversicherungsnehmercheckedval3inputaltercheckedval selbstbeteiligungsubmithandler functioninkl usa umaxdate365functioninarrayvalue param 1beitrag tarif17onchangedate function selectedform returnzahlweisetext einmalig elsepricehtmles istfalse ifismobile varget url wpcontentpluginshmrvapisearchphpzahlweisetext monatlichundefined ifh maxheightdateselecteddatevalueof varh5hidetarifvarianten1valauf den7var mindate newboxprice3 resultselbstbeteiligungresulthtmlweltweit1000 price3val1000format ddmmyyyy languageselbstbehaltifzahlweise1valtableuserinformationhide boxprice2nchst mglichen staffelpreismail4000 price3val4000ifprice3valdatavar yydgetfullyear varthisoptionalelement inarrayvalue paramdirekt per mailtarifvarianten1val 1searchform3 inputselbstbeteiligungvalueohnecheckedvalsum2 responseprice 1tofixed2replaceannually zahlweisetext jhrlichsearchform1 priceinfohtmlihrdirekt perinputversicherungsnehmervalue2checkedval searchform3deineget urlcyberversicherunginputversicherungsnehmercheckedval 1reisebeginn2valonchangedate functionmaxdate formatdateadddaysmindateelement param returnstaffelpreis price1valprice3val 4000 price3val4000headerform1051 inputdaterangefrberechnen success2000 searchform3 priceinfohtmlaltervar dddgetdate ifddpriceahoverfunctionifh maxheight maxheightmmdgetmonth1 ifmmpriceinfohtmlprice1val angepasstsearchform3grouperneut20false getpriceclickeinmaliginvalid invalidhandlerresponseprice 1tofixed2replacejahreprice1valproductname3valjahresreisercktrittschutzjetzt informierenparam 1 jqueryformat27type get urlnchsturl wpcontentpluginshmrvapisearchphprequired true numberpriceinfohtml else ifprice1valmglichen staffelpreis price3validdirektresulthtmleinzelpersonihr beitragcase 1true ignore rulesifmaxheight 0usareisepreis submithandler functionresulttarif resulthtmleinzelperson elsemaxheight 0price3val 20005000 searchform3else ifpricevalh ifmaxheightistnumberreiseversicherung imifmaxheight4000 price3valifsearchform3alertnixprice3val5000ifmm 10 varelse zahlweisetextmm 0mmsearchform3 inputselbstbeteiligungvaluemitcheckedvalsearchform1 priceinfohtmlihr reisepreisesmonatlich elsemglichen10jetzt beitrag berechnenelement paramifprice3val 8000boxprice1 tableuserinformationshowifzahlweise3valsubmithandler function formparam 1beforesend functionpremium ifsearchform1max 10000inputlaufzeitvaluejahrescheckedval searchform3unser kundenservicemax 5000jetztdateselecteddatevalueof var maxdatepricehtmlsum2price3valinputdaterangeonchangedate1 jqueryformatvalidatornumberofinvalidsifprice3val 4000true onchangedate functionfunction selectedelse ifprice3val 10000formatdateadddaysmindatesearchform3 priceinfohtml elseifprice3val 1000 searchform3fehler altersearchform3 inputversicherungsnehmervalue1checkedvalsearchform1versicherungsnehmer28ifprice3val 10000debug true ignoreprice3val angepasstcustom variantsresponsepriceelse boxprice1iftypeofh undefined ifhsearchform3 inputversicherungsnehmervalue2checkedval searchform3getpreprice2attrdisabled disabledlanguageerneut berechnen successboxprice1 resultselbstbeteiligungifprice3val 4000 price3valcan252json beforesendresultreisezielswitchthisvalprice3val10000 searchform3number true maxproductname1valjahresreiseschutzitem2htmlvarinputlaufzeitvalueeinmalcheckedval searchform3ifprice3val 5000dddgetdate ifddwin this varzahnzusatzversicherungmglichen staffelpreistrue autoclosethisoptionalelementresult34once zahlweisetextprice3rulesadd requiredifismobileelse boxprice2 tableuserinformationhidegetpreprice2attrdisabledgefundenheaderform1051function selected varonce zahlweisetext einmaligselectedsb12price3val5000 searchform3ifismobile var maxheightsearchformvalidateu canprice3val2000 searchform3jsonurlajaxgefunden return falseelse boxprice3zumpriceinfohtmlihr reisepreismaxheight htrue autoclose trueurl wpcontentpluginshmrvapisearchphp datasearchformvalidate debug truefamgetpriceclicksuccess errorclassvar maxdatekundenservice schnellboxprice2 tableuserinformationhidesearchform2 inputreisezielcheckedvalelse boxprice2dnewcalendarweeks trueautoheightheightmaxheightbd24messagesbreakderparam return thisoptionalelementvar enddate1 productname1valjahresreiseschutz premiumheaderform103 inputdaterangemaxheightsie2000 price3valparamswitchthisval casezahlweisetext varmonatlich else zahlweisetextwurde auf0dd vartrue todayhighlightvar ddsearchform3 priceinfohtmlihr reisepreisandroidwebosiphoneipadipodblackberryitestnavigatoruseragent true falseprice3val searchform3searchform229price1val angepasst elsepriceinfohtmlihrtruestaffelpreis price1val angepasstim paketprivathaftpflichtversicherunginputlaufzeitvaluejahrescheckedvaleinmindate enddatepriceinfohtml breakmaxdateschadenelse ifprice3val 1000familie elsewinbeitrag berechnenelse ifprice3val 6000maxheight 0 autoheighteachfunctionebreak caseifprice3val 100searchform3 price3valstartdate 0dundefined ifhjahresstartdatetrue todayhighlight truevar maxheight 0basisinputchangefunctionif searchform2 inputlaufzeitvaluejahrescheckedvalnewwpcontentpluginshmrvapisearchphptodayhighlightselected varfehler reisepreis16inputversicherungsnehmercheckedval 2todayhighlight trueifsearchform3 inputlaufzeitvaluejahrescheckedval searchform39thisheight iftypeofhtrue max 10000productname2valcleverhealthselbstbeteiligungproductdetailname2valcleverhealthpremiummonatlichreisercktrittsversicherungversuchen siesie es0d calendarweeks trueboxprice2 resultreisezielusa uerrorclass invalid10 var mm5var ismobile androidwebosiphoneipadipodblackberryitestnavigatoruseragentsearchform3 price3rulesadd requiredresulttarif resulthtmleinzelpersonproductdetailname3valjahresreisercktrittelse ifsearchform3boxprice1 resulttarifjquerydocumentreadyfunctionsearchform2 inputlaufzeitvalueeinmalcheckedvaljhrlich elsereisepreis submithandlerfunction form returnboxprice3 tableuserinformationshowifmmwurde auf denvalidator31required falsesearchform2 inputversicherungsnehmercheckedvalvar sum2 responsepriceifprice1valifprice3val 1000 price3valparam returntarif einzelpersonelse ifprice3val 2000reiseendeannually zahlweisetextifh maxheightserviceversuchenreturn falsefamiliereiseende3valmonthly zahlweisetextgetprice3val4000jetzt beitrageinzelpersonaufifddeinzelperson paar familieein fehler aufgetretenbitteberechnenredfalse validclassprice3val1000 searchform3yydgetfullyeartrue submithandler functionreisebeginnprice3val5000 searchform3 priceinfohtmlihrdisabledinarrayvaluetrue number truegefunden returnberechnen jquerydocumentreadyfunctionif0 autoheighteachfunctione hvar ismobilevalidateformthisvar mmdata productnamemaxheight h ifmaxheightstaffelpreis price3val angepasstmaxheight maxheightzahlweisetexttitleshowifprice3val 500resulthtmlpaar familiestartdate 0d calendarweeks0resulttarifundefinedelse ifprice3val 5000mmresulttarif resulthtmlpaardateselecteddatevalueofinputselbstbeteiligungvaluemitcheckedvalif searchform2auslandskrankenversicherungyymmddproductdetailname1valjahresreiseschutz premiumifprice3val 4000 searchform3var mmdgetmonth1true numbersearchform3 priceinfohtmlprice3rulesaddifsearchform3 inputlaufzeitvalueeinmalcheckedvalweiterdatatypewurdepricehtmlsum2 zahlweisetextmmdgetmonth1den nchstohnesearchform3 priceinfohtmlihrautoheighteachfunctione helse zahlweisetext varsearchform3 price3rulesaddmaxdate45price3val100004000 price3val4000 searchform310000 price3val10000customautocloseformat ddmmyyyyinputselbstbeteiligungvalueohnecheckedvalsearchform2 inputaltercheckedvalreiseversicherung im paket10000 searchform3ifprice3val 2000ismobile androidwebosiphoneipadipodblackberryitestnavigatoruseragent trueproductdetailname3valreisercktrittprice3val1000 searchform3 priceinfohtmlihrannuallyvar maxdate formatdateadddaysmindatereturn false getpriceclickjqueryformatpriceinfohtmlihr reisepreis wurdeddmmyyyytypeinputversicherungsnehmerchangefunctionreturn thisoptionalelement inarrayvalueutrue ignorefehler aufgetretenbittedebug truezahlweisetext einmaligversuchen sie esproductdetailname3valreisercktritt basis plussearchformvalidate debugschnell und direktmm 0mm vardaysinputselbstbeteiligungcheckedval priceproductdetailname1valjahresreiseschutzsuccess errorclass invalidreisezieltarifimenddaterequiredplus ifsearchform3 inputlaufzeitvalueeinmalcheckedval35h thisheight

Longtail Keyword Density for Berlin-direktversicherung.de

KeywordsOccurences
reisepreis wurde auf55
nchst mglichen staffelpreis55
wurde auf den55
auf den nchst55
den nchst mglichen55
price-infohtmlihr reisepreis wurde55
mglichen staffelpreis price3val41
searchform3 price-infohtmlihr reisepreis41
staffelpreis price3val angepasst41
price3val angepasst else40
angepasst else ifprice3val38
price-infohtml else ifprice3val38
searchform3 price-infohtml else37
searchform1 price-infohtmlihr reisepreis14
staffelpreis price1val angepasst14
mglichen staffelpreis price1val14
price1val angepasst else13
price-infohtml else ifprice1val12
angepasst else ifpriceval12
number true max8
true number true8
required true number8
basis plus ifsearchform36
calendarweeks true autoclose6
box-price2 table-user-informationshow box-price26
true todayhighlight true6
autoclose true todayhighlight6
submithandler function form6
format ddmmyyyy language6
language de startdate6
true autoclose true6
else ifprice3val 10006
else ifprice3val 20006
else ifprice3val 40006
var mindate new5
box-price1 table-user-informationshow box-price15
usa u can5
productdetailname3valjahres-reisercktritt basis plus4
var dd 0dd4
0mm var yydgetfullyear4
else ifprice3val 5004
mm 0mm var4
var mm 0mm4
10 var mm4
ifmm 10 var4
mmdgetmonth1 ifmm 104
var mmdgetmonth1 ifmm4
dd 0dd var4
10 var dd4
ifsearchform3 inputlaufzeitvalueeinmalcheckedval searchform34
ifdd 10 var4
dddgetdate ifdd 104
var dddgetdate ifdd4
true max 100004
else ifprice3val 50004
else ifprice3val 60004
else ifprice3val 80004
10000 price3val10000 searchform34
price3val10000 searchform3 price-infohtmlihr4
else ifprice3val 100004
var yydgetfullyear var4
0dd var mmdgetmonth14
searchform3 inputversicherungsnehmervalue1checkedval searchform34
box-price3 table-user-informationshow box-price34
productdetailname3valreisercktritt basis plus4
true max 50004
else ifprice3val 30004
price3rulesadd required true4
1 productname1valjahres-reiseschutz premium4
searchform3 price3val searchform34
searchform3 price3rulesadd required4
tarifvarianten1val 1 productname1valjahres-reiseschutz4
productname3valjahres-reisercktrittschutz basis plus4
ifsearchform3 inputlaufzeitvaluejahrescheckedval searchform34
searchform3 inputversicherungsnehmervalue2checkedval searchform34
selected var mindate3
2000 searchform3 price-infohtml3
ifprice3val 2000 searchform33
form return false3
1000 searchform3 price-infohtml3
function form return3
debug true submithandler3
function selected var3
true submithandler function3
true onchangedate function3
searchformvalidate debug true3
1000 price3val1000 searchform33
todayhighlight true onchangedate3
onchangedate function selected3
ifprice3val 2000 price3val3
price3val5000 searchform3 price-infohtmlihr3
price3val 4000 price3val40003
ifprice3val 1000 searchform33
plus ifsearchform3 inputlaufzeitvalueeinmalcheckedval3
price3val4000 searchform3 price-infohtmlihr3
price3val1000 searchform3 price-infohtmlihr3
plus ifsearchform3 inputlaufzeitvaluejahrescheckedval3
price3val2000 searchform3 price-infohtmlihr3
4000 price3val4000 searchform33
startdate mindate enddate3
5000 price3val5000 searchform33
var maxdate formatdateadddaysmindate3
dateselecteddatevalueof var maxdate3
new dateselecteddatevalueof var3
mindate new dateselecteddatevalueof3
ifprice3val 4000 searchform33
4000 searchform3 price-infohtml3
ifprice3val 4000 price3val3
ifprice3val 1000 price3val3
unser kundenservice schnell3
0d calendarweeks true3
return thisoptionalelement inarrayvalue3
ifh maxheight maxheight3
maxheight maxheight h3
maxheight h ifmaxheight3
h ifmaxheight 03
ifmaxheight 0 autoheightheightmaxheight3
element param return3
param return thisoptionalelement3
thisoptionalelement inarrayvalue param3
iftypeofh undefined ifh3
inarrayvalue param -13
param -1 jqueryformat3
debug true ignore3
true ignore rules3
fehler reisepreis submithandler3
reisepreis submithandler function3
productdetailname1valjahres-reiseschutz premium ifsearchform13
ajax type get3
undefined ifh maxheight3
thisheight iftypeofh undefined3
get url wp-contentpluginshmrvapisearchphp3
var ismobile androidwebosiphoneipadipodblackberryitestnavigatoruseragent3
direkt per mail3
reiseversicherung im paket3
tarif einzelperson paar3
einzelperson paar familie3
jetzt beitrag berechnen3
beitrag berechnen jquerydocumentreadyfunction3
win this var3
ismobile androidwebosiphoneipadipodblackberryitestnavigatoruseragent true3
h thisheight iftypeofh3
androidwebosiphoneipadipodblackberryitestnavigatoruseragent true false3
true false ifismobile3
false ifismobile var3
ifismobile var maxheight3
var maxheight 03
maxheight 0 autoheighteachfunctione3
0 autoheighteachfunctione h3
autoheighteachfunctione h thisheight3
type get url3
url wp-contentpluginshmrvapisearchphp data3
startdate 0d calendarweeks3
success errorclass invalid3
aufgetretenbitte versuchen sie3
versuchen sie es3
alertnix gefunden return3
gefunden return false3
return false validclass3
false validclass success3
validclass success errorclass3
errorclass invalid invalidhandler3
ein fehler aufgetretenbitte3
break case 23
schnell und direkt3
ihr beitrag tarif3
if searchform2 inputlaufzeitvalueeinmalcheckedval3
if searchform2 inputlaufzeitvaluejahrescheckedval3
else if searchform23
else box-price2 table-user-informationhide3
box-price2 table-user-informationhide box-price23
fehler aufgetretenbitte versuchen3
ist ein fehler3
wp-contentpluginshmrvapisearchphp data productname3
zahlweisetext monatlich else3
datatype json beforesend3
json beforesend function3
erneut berechnen success3
once zahlweisetext einmalig3
zahlweisetext einmalig else3
annually zahlweisetext jhrlich3
zahlweisetext jhrlich else3
monthly zahlweisetext monatlich3
monatlich else zahlweisetext3
pricehtmles ist ein3
else zahlweisetext var3
zahlweisetext var sum23
var sum2 responseprice3
sum2 responseprice 1tofixed2replace3
resulttarif resulthtmleinzelperson else3
resulttarif resulthtmlpaar familie3
resulthtmlpaar familie else3
inkl usa u3
return false getpriceclick3
else ifprice3val76
nchst mglichen55
mglichen staffelpreis55
den nchst55
auf den55
wurde auf55
reisepreis wurde55
price-infohtmlihr reisepreis55
angepasst else53
price-infohtml else50
price3val angepasst41
staffelpreis price3val41
searchform3 price-infohtmlihr41
searchform3 price-infohtml40
required true26
basis plus16
staffelpreis price1val14
price1val angepasst14
searchform1 price-infohtmlihr14
if searchform212
else ifpriceval12
else ifprice1val12
10 var8
true number8
number true8
true max8
break case7
function form7
ifprice3val 10007
submithandler function6
todayhighlight true6
ohne sb6
header-form-103 input-daterange6
ifprice3val 40006
ifprice3val 20006
return false6
debug true6
table-user-informationshow box-price26
plus ifsearchform36
box-price2 table-user-informationshow6
true todayhighlight6
autoclose true6
true autoclose6
calendarweeks true6
ddmmyyyy language6
format ddmmyyyy6
header-form-1051 input-daterange6
ifprice3val 5005
u can5
mindate new5
var mindate5
usa u5
table-user-informationshow box-price15
box-price1 table-user-informationshow5
required false5
10000 searchform35
jetzt informieren5
productname3valjahres-reisercktrittschutz basis4
var mmdgetmonth14
productdetailname3valjahres-reisercktritt basis4
box-price3 table-user-informationshow4
table-user-informationshow box-price34
mmdgetmonth1 ifmm4
else ifsearchform34
max 50004
0dd var4
inputlaufzeitvaluejahrescheckedval searchform34
dd 0dd4
searchform3 price3val4
price3val searchform34
searchform3 price3rulesadd4
price3rulesadd required4
5000 searchform34
var dd4
formatdateadddaysmindate 3654
ifsearchform3 inputlaufzeitvaluejahrescheckedval4
dddgetdate ifdd4
inputlaufzeitvalueeinmalcheckedval searchform34
var yydgetfullyear4
max 100004
yydgetfullyear var4
var enddate4
price-infohtml break4
ifsearchform3 inputlaufzeitvalueeinmalcheckedval4
searchform3 inputversicherungsnehmervalue1checkedval4
searchform3 inputselbstbeteiligungvalueohnecheckedval4
inputversicherungsnehmervalue1checkedval searchform34
searchform3 inputselbstbeteiligungvaluemitcheckedval4
var mm4
productdetailname3valreisercktritt basis4
ifmm 104
searchform3 inputversicherungsnehmervalue2checkedval4
inputversicherungsnehmervalue2checkedval searchform34
ifdd 104
var dddgetdate4
mm 0mm4
var dnew4
tarifvarianten1val 14
1 productname1valjahres-reiseschutz4
productname1valjahres-reiseschutz premium4
productdetailname1valjahres-reiseschutz premium4
validateformthis comparedate4
ifprice3val 100004
price3val10000 searchform34
10000 price3val100004
ifprice3val 80004
ifprice3val 60004
ifprice3val 50004
else box-price24
ifprice3val 30004
reiseversicherung im4
var startdate4
65 jahre4
0mm var4
function selected3
startdate 0d3
true onchangedate3
berechnen jquerydocumentreadyfunction3
mindate enddate3
ifismobile var3
var win3
var ismobile3
false ifismobile3
0d calendarweeks3
ismobile androidwebosiphoneipadipodblackberryitestnavigatoruseragent3
startdate mindate3
maxdate formatdateadddaysmindate3
onchangedate function3
dateselecteddatevalueof var3
new dateselecteddatevalueof3
selected var3
true false3
androidwebosiphoneipadipodblackberryitestnavigatoruseragent true3
var maxdate3
reisepreis submithandler3
beitrag berechnen3
4000 price3val3
2000 price3val3
price3val 40003
4000 price3val40003
price3val4000 searchform33
direkt per3
4000 searchform33
5000 price3val50003
per mail3
price3val5000 searchform33
kundenservice schnell3
searchformvalidate debug3
true submithandler3
form return3
false getpriceclick3
2000 searchform33
price3val2000 searchform33
jetzt beitrag3
paar familie3
box-price3 resulttarif3
else box-price33
box-price3 resultselbstbeteiligung3
jahre ab3
alter bis3
ifprice3val 1003
einzelperson paar3
price3val 20003
tarif einzelperson3
im paket3
schaden melden3
1000 price3val10003
price3val1000 searchform33
1000 searchform33
1000 price3val3
var maxheight3
getpreprice2attrdisabled disabled3
formatdateadddaysmindate 453
else ifsearchform13
var sum23
sum2 responseprice3
responseprice 1tofixed2replace3
pricehtmlsum2 zahlweisetext3
inputversicherungsnehmercheckedval 13
fehler alter3
fehler versicherungsnehmer3
box-price1 resulttarif3
resulttarif resulthtmleinzelperson3
resulthtmleinzelperson else3
inputversicherungsnehmercheckedval 23
else zahlweisetext3
resulttarif resulthtmlpaar3
resulthtmlpaar familie3
familie else3
else box-price13
resulttarif resulthtml3
resultreiseziel resulthtmlweltweit3
inkl usa3
ignore rules3
box-price1 resultselbstbeteiligung3
pricehtmles ist3
zahlweisetext var3
monatlich else3
ein fehler3
datatype json3
fehler selbstbeteiligung3
premium ifsearchform13
ajax type3
type get3
get url3
url wp-contentpluginshmrvapisearchphp3
wp-contentpluginshmrvapisearchphp data3
data productname3
inputaltercheckedval selbstbeteiligung3
inputselbstbeteiligungcheckedval price3
json beforesend3
zahlweisetext monatlich3
beforesend function3
erneut berechnen3
berechnen success3
once zahlweisetext3
zahlweisetext einmalig3
einmalig else3
annually zahlweisetext3
zahlweisetext jhrlich3
jhrlich else3
monthly zahlweisetext3
ist ein3
fehler aufgetretenbitte3
maxheight 03
searchform2 inputreisezielcheckedval3
undefined ifh3
ifprice1val 10003
ihr beitrag3
beitrag tarif3
getprice2attrdisabled disabled3
iftypeofh undefined3
searchform2 inputlaufzeitvalueeinmalcheckedval3
searchform2 inputlaufzeitvaluejahrescheckedval3
searchform2 inputversicherungsnehmercheckedval3
searchform2 inputaltercheckedval3
thisheight iftypeofh3
maxheight maxheight3
h thisheight3
box-price2 resulttarif3
else if3
box-price2 table-user-informationhide3
table-user-informationhide box-price23
box-price2 resultreiseziel3
box-price2 resultalter3
fehler reisepreis3
autoheighteachfunctione h3
0 autoheighteachfunctione3
ifh maxheight3
maxheight h3
aufgetretenbitte versuchen3
switchthisval case3
versuchen sie3
sie es3
alertnix gefunden3
gefunden return3
true ignore3
false validclass3
validclass success3
success errorclass3
errorclass invalid3
invalid invalidhandler3
case 13
h ifmaxheight3
-1 jqueryformat3
case 23
param -13
inarrayvalue param3
thisoptionalelement inarrayvalue3
return thisoptionalelement3
param return3
element param3
unser kundenservice3
0 autoheightheightmaxheight3
ifmaxheight 03
custom variants3
searchform3140
else135
price3val82
ifprice3val79
var66
true63
reisepreis60
auf57
price-infohtml56
price-infohtmlihr55
wurde55
den55
mglichen55
staffelpreis55
angepasst55
nchst55
searchform253
function38
searchform135
required32
box-price228
price1val27
box-price122
if22
box-price320
false18
018
117
217
ifsearchform316
basis16
plus16
315
table-user-informationshow15
return15
415
515
zahlweisetext15
fehler15
ifprice1val14
613
break13
case13
input-daterange12
ifpriceval12
startdate12
ohne12
711
mindate11
811
911
inputversicherungsnehmercheckedval11
inputselbstbeteiligungcheckedval11
1011
ifsearchform110
jahre10
alter10
1110
sie10
jetzt9
maxheight9
premium9
enddate9
resulttarif9
number8
max8
128
reiseversicherung8
disabled8
validateformthis8
inputchangefunction8
137
inputaltercheckedval7
new7
form7
inputversicherungsnehmervalue2checkedval7
resulthtml7
table-user-informationhide7
formatdateadddaysmindate7
147
inputversicherungsnehmervalue1checkedval7
inputlaufzeitvalueeinmalcheckedval7
inputlaufzeitvaluejahrescheckedval7
tarif6
inputselbstbeteiligungvaluemitcheckedval6
jquerydocumentreadyfunction6
percent6
header-form-1036
reiseziel6
todayhighlight6
resultselbstbeteiligung6
success6
156
im6
sb6
comparedate6
autoclose6
familie6
param6
h6
header-form-10516
ihr6
debug6
format6
berechnen6
beitrag6
maxdate6
ddmmyyyy6
inputselbstbeteiligungvalueohnecheckedval6
calendarweeks6
language6
submithandler6
166
selbstbeteiligung6
versicherungsnehmer6
175
185
195
usa5
u5
can5
es5
205
215
225
235
245
255
265
275
285
295
305
315
informieren5
jahres5
kontakt5
unser5
fam5
zahnzusatzversicherung5
bis5
service5
custom5
red4
price4
mmdgetmonth14
inputaltervalue1click4
maxdate3654
ahoverfunction4
deine4
reisebeginn4
productdetailname2valcleverhealth4
dddgetdate4
productname2valcleverhealth4
dnew4
fr4
ifdd4
dd4
productdetailname1valjahres-reiseschutz4
productname1valjahres-reiseschutz4
tarifvarianten1val4
yymmdd4
yydgetfullyear4
0mm4
mm4
ifmm4
cyberversicherung4
reiseende4
zum4
price3rulesadd4
responseprice4
result4
days4
variants4
price3val100004
mit4
resultreiseziel4
selbstbehalt4
reisebeginn2val4
324
productdetailname3valreisercktritt4
inputreisezielcheckedval4
0dd4
productdetailname3valjahres-reisercktritt4
direkt4
productname3valjahres-reisercktrittschutz4
reiseende2val4
ismobile3
win3
ab3
onchangedate3
einzelperson3
0d3
paket3
paar3
dateselecteddatevalueof3
selected3
jhrlich3
uns3
reisercktrittsversicherung3
ts3
getpriceclick3
searchformvalidate3
id3
item3html3
item2html3
clearintervalbarinterval3
price3val50003
price3val40003
price3val20003
price3val10003
validatornumberofinvalids3
ifzahlweise3val3
reiseende3val3
bd243
reisebeginn3val3
kundenservice3
schnell3
per3
mail3
fahrrad3
privathaftpflichtversicherung3
schaden3
melden3
wir3
der3
getprice3attrdisableddisabled3
androidwebosiphoneipadipodblackberryitestnavigatoruseragent3
undefined3
333
alertnix3
pricehtmles3
ist3
ein3
aufgetretenbitte3
versuchen3
json3
gefunden3
titlehide3
validclass3
errorclass3
invalid3
invalidhandler3
validator3
inputversicherungsnehmerchangefunction3
h5hide3
beforesend3
datatype3
resulthtmleinzelperson3
monatlich3
sum23
1tofixed2replace3
pricehtmlsum23
annually3
einmalig3
once3
pricehtml3
resulthtmlpaar3
ifzahlweise1val3
h5show3
resulthtmlweltweit3
titleshow3
343
erneut3
switchthisval3
inputaltervalue2removeattrdisabled3
ifismobile3
getpreprice2attrdisabled3
element3
validatoraddmethodequals3
autoheightheightmaxheight3
ifmaxheight3
ifzahlweise2val3
resultalter3
switch3
inarrayvalue3
ccc3
ifh3
monthly3
iftypeofh3
thisheight3
autoheighteachfunctione3
maxdate453
thisoptionalelement3
getprice2attrdisabled3
group3
get3
zahlweise3
productdetailname3
productname3
data3
wp-contentpluginshmrvapisearchphp3
url3
type3
353
ajax3
messages3
rules3
ignore3
jqueryformat3
weiter3
auslandskrankenversicherung3
inkl3

Who hosts Berlin-direktversicherung.de?

Berlin-direktversicherung.de Hosting Provider Information

Hosted IP Address:134.119.241.143
Hosted Hostname:m12s3-1-9da.ispgateway.de
Service Provider:domainfactory GmbH
Hosted Country:GermanyDE
Location Latitude:51.4476
Location Longitude:7.0122
Webserver Software:Apache

Is "domainfactory GmbH" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
domainfactory GmbH
0.0894%

HTTP Header Analysis for Berlin-direktversicherung.de

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Wed, 28 Oct 2020 14:15:20 GMT
Server: Apache
Location: https://www.berlin-direktversicherung.de/
Content-Length: 249
Content-Type: text/html; charset=iso-8859-1

Berlin-direktversicherung.de Domain Nameserver Information

HostIP AddressCountry
ns1.brandshelter.com 178.33.33.199
ns2.brandshelter.de 188.165.164.191
ns3.brandshelter.info 94.23.156.156
ns4.brandshelter.net 192.95.19.131
ns5.brandshelter.us 192.95.17.188


Need to find out who hosts Berlin-direktversicherung.de?


Domain Registration (WhoIs) information for Berlin-direktversicherung.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: berlin-direktversicherung.de
Nserver: ns1.brandshelter.com
Nserver: ns2.brandshelter.de
Nserver: ns3.brandshelter.info
Nserver: ns4.brandshelter.net
Nserver: ns5.brandshelter.us
Status: connect
Changed: 2018-06-18T08:19:12+02:00

Websites with Similar Names

Berli-crm.com
Start - berliCRM - Das deutsche Open-Source CRM
Berli.asia
Index of /
Berli.dev
Laurin Berli | Webdesign
Berli.kim
Kimberli Zhong
Berli.online
403 Forbidden
Berliaccablesandwires.com
Berliac Group | Cables and Wires
Berliamchile.com
403 Forbidden
Berliamlatam.com
403 Forbidden

Recently Updated Websites

Thelifecompanyllc.com (2 seconds ago.)Dylanandpayton.com (2 seconds ago.)Duvandertrading.dk (5 seconds ago.)Hollychex.com (6 seconds ago.)Nock-realty.com (8 seconds ago.)Phimhayhapdan1503.com (8 seconds ago.)Founderscorp.org (11 seconds ago.)Cultthegame.com (11 seconds ago.)Meddisafe.com (12 seconds ago.)Ranonlineasia.com (13 seconds ago.)Makrobet121.com (17 seconds ago.)Nathanielchandler.com (23 seconds ago.)Jasoftsolution.com (23 seconds ago.)Simpleyetcharmingco.com (25 seconds ago.)Brendawhitton.com (30 seconds ago.)Michaelhorrace.com (31 seconds ago.)911.tokyo (34 seconds ago.)Pettechnicians.com (35 seconds ago.)Thelighthousealliance.com (36 seconds ago.)Wagons4warriors.org (37 seconds ago.)Twistedplots.boutique (38 seconds ago.)Ferncreek-crossfit.com (43 seconds ago.)Fundacionamigosrealmadrid.cl (44 seconds ago.)Todaysskill.com (46 seconds ago.)Wendysmiller.info (46 seconds ago.)Jayceephotography.com (48 seconds ago.)Ife.email (48 seconds ago.)Bouwwatch.info (50 seconds ago.)Howardsterncritic.com (51 seconds ago.)Eineblumemusic.com (53 seconds ago.)

Recently Searched Keywords

long june (1 second ago.)marshall islands port code (2 seconds ago.)რელიგია (3 seconds ago.)이벤트 (3 seconds ago.)cute baby pic for fb dp download (4 seconds ago.)cute baby pics download for whatsapp dp share chat (5 seconds ago.)ml4000 zzobacz szczegynowosensation (5 seconds ago.)zozonguyen (7 seconds ago.)background-colorrgba255 (8 seconds ago.)cute baby girl pic dpz (9 seconds ago.)xưởng may chân váy công sở... (10 seconds ago.)cute baby girl pic for fb dp download (11 seconds ago.)vuvuvu (11 seconds ago.)yt i aplikimit (13 seconds ago.)get async (13 seconds ago.)tại sao khách hàng tin tưởng lựa chọn dịch vụ của du lịch khát vọng việt (13 seconds ago.)cute baby photos for dp download (14 seconds ago.)cute baby girl images for dp download (15 seconds ago.)งานปัก (18 seconds ago.)memory care (21 seconds ago.)available homes (22 seconds ago.)0sqs-slide-wrapperdata-slide-typelock-screen (24 seconds ago.)dussehra (24 seconds ago.)защита голени (25 seconds ago.)n2-font-49a5263685b4a232aaa66f6cbc4c7fa1-paragraph (26 seconds ago.)tranny shemale (26 seconds ago.)vertical 3 both (28 seconds ago.)bathmate (29 seconds ago.)stewart (31 seconds ago.)azdha (31 seconds ago.)