|  Computers, TVs, Video Games & Appliances - Best Buy Canada
High trust score  | 
Get our Lowest Price Guarantee, online or in store, on a huge selection of laptops & tablets, TVs, headphones, video games, appliances and more. Website Information has a High trust score, a Statvoo Rank of B, an Alexa Rank of 1,436, a Majestic Rank of 10,327, a Domain Authority of 69% and is not listed in DMOZ. is hosted by Best Buy Co., Inc. in Minnesota, Minneapolis, United States, 55423. has an IP Address of and a hostname of

The domain was registered 1 decade 9 years 2 days ago by , it was last modified 4 years 5 months 1 week ago and currently is set to expire 2 years 4 months 1 week ago.

Whois information for

Full Whois Lookup for Whois Lookup

Domain name:
Domain status: registered
Creation date: 2000/10/17
Expiry date: 2019/06/11
Updated date: 2017/05/10
DNSSEC: Unsigned

Name: MarkMonitor International Canada Ltd.
Number: 5000040

Name: Best Buy Canada Ltd.

Administrative contact:
Name: Colin Macrae
Postal address: 8800 Glenlyon Pkwy
Burnaby BC V5J5K3 Canada
Phone: +1.6044121864
Email: Login to show email
Name: Colin Macrae
Postal address: 8800 Glenlyon Pkwy
Burnaby BC V5J5K3 Canada
Phone: +1.6044121864
Email: Login to show email

% WHOIS look-up made at 2017-08-18 14:33:05 (GMT)
% Use of CIRA's WHOIS service is governed by the Terms of Use in its Legal
% Notice, available at
% (c) 2017 Canadian Internet Registration Authority, (

Who hosts Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Best Buy Co., Inc.
Hosted Country:United StatesUS
Location Latitude:44.8784
Location Longitude:-93.2794
Webserver Software:unknown

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=utf-8
X-XSS-Protection: 1;mode=block
Content-Security-Policy: frame-ancestors http://* https://* http://* https://*
Strict-Transport-Security: max-age=604800
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 59395
Cache-Control: private, no-store
Date: Mon, 08 Jun 2015 18:52:09 GMT
Connection: keep-alive

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

electronicsbackgroundrepeatbrandsshop now saveexperienceapply1pxvaluepropositionshop nowbeautytoys dronessolidliappsmallmovieswidth styles mediadrivewatchesends augustprintcookeramp recreationmajordeskdealshdsquadsavecar electronicsfriendsfamilyhero hidefortabletpaddingusrecreationnow saveshop weeklyaugust 244pxhidefortablet display nonekeyboards40 sale endsgpsamp home theatreproductsmultiroomtabletsinstrumentssigngamesheadphonesmaternity8px0px 8pxdroneliving1automembershiphealtharticlesguitarsmobiletablet styles friendsfamilyhero8px 0px 0pxhidefortablet display32pxbackgroundrepeat norepeatfriendsfamilyhero hidefortablet displaysuppliesgetdrones0fff 100promo1portablehardshopabsoluteyou003b64kidsvideo24 2017equipmentjewelrytablet styles0px 42a133luggageoutshowcase see allaudio ampvideo gamescelltvbackgroundpositionbottom3all articleslearngreatstyles friendsfamilyhero hidefortablettechdrones ampseeendssecurity0px 0px 42a133smart homeappliancessale ends augustallhidefortabletaccessoriesshop newhome theatrevacuumsoffice suppliesintosee all articlestabletsave 40 saleabsolute topliveaudiosupportdigitalledcomputers tabletscell phonesfaxtoysrightapplebestoculusconditions8px 0pxkitchensportscreditwidthmoredisplay nonesportcases ampstylesscannersprinters scannersiphone0px 0px24 2017 shopleftink5riftmusical instrumentsffbaroculus riftclearout dealsbts1bignewbest buynow save upwirelessultra4centermediaselectaugsee allpatiohard drivedevicessaleexcitinginkjettv ampessentialsmycentrelibtsflyoutelectricbuy showcasesensorsnonebackgroundcasesgamingupposition absolute topbuyfitness2px solid fffvirtualsmart locksmultiroom audiosave upbluetoothamp homeluggage ampsmartwatchesmainfeatureherobuy showcase seetechnology0pxspeakerspositionorderclearoutvalueproposition liweeklycameras camcordersfind a storefurniture shop4kcontrolsaction6now augustcamcordersheadsetshomeappsmainherobabycamerasaugust 24 2017nintendofunctionphonesprotectiontvscontrolamp accessoriesmore shopstorecameranorepeatfffrealitystyles friendsfamilyherosale on nowschool essentials16pxcomputersampfurniturepccheckpricefriendsfamilyherot6wireless multiroomlaptopsroominstantprintersmusical14pxshippingsmartphoneshp0fffscreenbackgeekdoorlaptopmarginfurniture shop nowwearable technologyends august 2440 salebest buy showcaseshowcase seecableshottestplayersmaxwidthhelpsavingsdisplayaug 18desktopsstyles mediaaircardamp carcoloryourmonitorscreateback to schoolsave 40heighttv amp homeonebagstracking2wearablebaby amphomewidth styles2017 shop nowaugustsports amp recreationcredit cardandroidcardslearn moreplaystationlocksaccountonlyhugeoutdoorsale endsfurniture amptheatreaccessamp bagsamp officeramvisitbackgroundposition 32px2px solidtraveltracking devicesonlineplansmargin 0schoolwireless multiroom audioxboximgfindovershop allgeek squadposition absoluteshowcase0px 8px 0pxofficepersonaljavascriptoffice furnituresports amptopvirtual realitynow0solid fff2017 shop42a133ink ampsmartcar2pxprinter

Longtail Keyword Density for

2017 shop now9
sale ends august9
august 24 20178
ends august 248
24 2017 shop8
back to school6
now save up4
hide-for-tablet display none4
width styles media4
sale on now4
shop now save4
0px 0px 42a1333
8px 0px 0px3
0px 8px 0px3
see all articles3
40 sale ends3
save 40 sale3
best buy showcase3
amp home theatre3
wireless multi-room audio3
tv amp home3
2px solid fff3
find a store3
furniture shop now3
sports amp recreation3
position absolute top3
buy showcase see3
friends-family-hero hide-for-tablet display3
styles friends-family-hero hide-for-tablet3
tablet styles friends-family-hero3
showcase see all3
shop now46
shop all20
best buy19
home theatre11
2017 shop9
ends august9
sale ends9
august 248
learn more8
24 20178
amp accessories7
background-position -32px6
display none6
smart home5
position absolute5
audio amp5
see all5
virtual reality5
cell phones5
office supplies5
shop new4
geek squad4
0fff 1004
styles friends-family-hero4
more shop4
hide-for-tablet display4
luggage amp4
absolute top4
amp home4
computers tablets4
value-proposition li4
tablet styles4
width styles4
ink amp4
save up4
all articles4
styles media4
now save4
sports amp4
0px 0px4
friends-family-hero hide-for-tablet3
showcase see3
40 sale3
0px 8px3
8px 0px3
0px 42a1333
save 403
shop weekly3
margin 03
hard drive3
aug 183
buy showcase3
now august3
furniture shop3
amp office3
printers scanners3
office furniture3
tv amp3
multi-room audio3
wireless multi-room3
amp bags3
amp car3
2px solid3
credit card3
solid fff3
school essentials3
cases amp3
cameras camcorders3
drones amp3
furniture amp3
video games3
amp recreation3
toys drones3
clearout deals3
musical instruments3
baby amp3
smart locks3
car electronics3
wearable technology3
tracking devices3
oculus rift3
background-repeat no-repeat3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Canada Canada Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?