Best Russian Brides Offer Sweet Dating To You – Find Lovely Single Russian Girls And Have Fun

Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: 20,764
Estimated Worth: $1,168,560
Category: This site has not been categorized yet

Russian mail order brides that dwell on the dating site will be an excellent choice for those men who dream about Russian single women. Meet a wonderful paramour and make one of the ladies your wife – that is super easy thanks to the dating site.



Domain summary

Last updated
2020-10-18
Domain label
bestrussianbrides
Domain extension
net
Domain registered:
2019-07-05
Domain updated:
2020-06-05
Global Traffic Rank
20,764
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$1,168,560
Estimated daily income
$1,623
Estimated monthly income
$49,366

Frequently Asked Questions (FAQ)

Q: When was Bestrussianbrides.net registered?
A: Bestrussianbrides.net was registered 2 years, 2 months, 2 weeks, 4 days, 8 hours, 29 minutes, 51 seconds ago on Friday, July 5, 2019.
Q: When was the WHOIS for Bestrussianbrides.net last updated?
A: The WHOIS entry was last updated 1 year, 3 months, 2 weeks, 4 days, 8 hours, 29 minutes, 51 seconds ago on Friday, June 5, 2020.
Q: What are Bestrussianbrides.net's nameservers?
A: DNS for Bestrussianbrides.net is provided by the following nameservers:
  • doug.ns.cloudflare.com
  • sima.ns.cloudflare.com
Q: Who is the registrar for the Bestrussianbrides.net domain?
A: The domain has been registered at NAMECHEAP INC..
Q: What is the traffic rank for Bestrussianbrides.net?
A: Bestrussianbrides.net ranks 20,764 globally on Alexa. Bestrussianbrides.net has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Bestrussianbrides.net each day?
A: Bestrussianbrides.net receives approximately 135,229 visitors and 811,374 page impressions per day.
Q: What IP address does Bestrussianbrides.net resolve to?
A: Bestrussianbrides.net resolves to the IPv4 address 172.67.199.84.
Q: In what country are Bestrussianbrides.net servers located in?
A: Bestrussianbrides.net has servers located in the United States.
Q: What webserver software does Bestrussianbrides.net use?
A: Bestrussianbrides.net is powered by CloudFlare webserver.
Q: Who hosts Bestrussianbrides.net?
A: Bestrussianbrides.net is hosted by T-Mobile USA, Inc. in United States.
Q: How much is Bestrussianbrides.net worth?
A: Bestrussianbrides.net has an estimated worth of $1,168,560. An average daily income of approximately $1,623, which is roughly $49,366 per month.

Bestrussianbrides.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Bestrussianbrides.net Free SEO Report

Website Inpage Analysis for Bestrussianbrides.net

H1 Headings

1 :
  1. Russian mail order bride sites

H2 Headings

3 :
  1. Find Russian bride – your truly princess 
  2. Russian women – marvelous and beautiful 
  3. Russian brides – your dream girls

H3 Headings

12 :
  1. What type of relationships are you looking for?
  2. Find a Russian wife – where can be they found?
  3. Mail order brides facts – what does play an important role?
  4. Russian mail order brides – your best marriage agency 
  5. Meet Russian bride – where can be they found?
  6. Single russian women
  7. Find a Russian bride
  8. Potential Russian bride
  9. Beautiful Russian girls
  10. Russian girls
  11. Russian dream girls
  12. Russian girls for marriage

H4 Headings

0 :

H5 Headings

6 :
  1. Marriage
  2. Chatting
  3. Regular meetings
  4. Dating
  5. Choose your relationships goal
  6. What type of relationships are you looking for?

H6 Headings

3 :
  1. Brides by country
  2. Best dating sites of 2019
  3. About us

Total IFRAMEs

1 :

Total Images

28 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

1:

Links - Outbound (nofollow)

0:

Keyword Cloud for Bestrussianbrides.net

15sbecausemany men5listitem listitems0 listitemstyledisplayheif listitemshowworldwouldobserverconst showmore documentcreateelementspansuccessorder brideskeycarebeautifulmeet6listitemstyledisplay nonelistqueryselectoralllidoesbstuptransform 15s linearimportantmeetingsalsodocumentdocumentelementclientwidthlastlinkreallyevenifthereforeunlistitemsforeachlistitem ifmail ordermanlistitemsforeachlistitem if listitemcoursenoneimpressionfurthermorecontinuerussian girlsnot haveshowmorestyledisplayshowmore0substrsaidaddlistitemsforeachlistitemget to know3lethasstrshowmore documentcreateelementspan showmoreclasslistaddshowmorepartextbridetransformtransitionveryflexibleblockcssamongrussian womenbeautyspecialevent eventpreventdefaultseeliststheyshowmoreaddeventlistenerclick functiondayshow moreadditionjquerydocumentreadyfunctionthereif documentdocumentelementclientwidthlistitemoptionsyoudatatransition transform 15stopunlistitemsforeachlistitemnotexpectshemarrymakecaralreadylistitemstyledisplaydreamrussian womandotogether15s linear zindexromantictransform 15snulleventpreventdefaultleastlotif listitem unlistitems0transition transformrussian bridefeminineshouldwomen oftenwellnone const showmoretimeif documentdocumentelementclientwidth 1200sousuallyshowmoreclasslistaddshowmorepartextmarriageopacitywetheirshowmoreinnertext show morelistitems0asiangetdocumentcreateelementspan showmoreclasslistaddshowmorepartext showmoreinnertextlistitem unlistitems0foreignersshowmore documentcreateelementspandatingcan01eventoftenwesternnbspcenterrussianshairlinkkeysomethingdating serviceput2onlyflexlinearperfecthavecovercustsidedocumentqueryselectorallheadlocktakelistitems0 listitemstyledisplaywantshowmoreclasslistaddshowmorepartext showmoreinnertextrefrussiansettimeoutfunctionhersumfirstquizyou canshowsflowersflexibleblockallrussiapcversion1womanjquerydocumentreadyfunction functiongoodlistitemstyledisplay none constmanysmallfalse7romanceformsif listtextcontentlengthunlistitems0 listitemstyledisplaymoretheselistitemsforeachlistitem ifbestmaxserviceelse ifease opacitydoes notordernewafterstartyourunlistitems0somelisttextcontentlengthminnone constshowmorestyledisplay nonecan notshowmoreinnertextthemselvesif listitem listitems0yourselfolfindlifirstchilddocumentcreateelementspan4bigzindex 500likedocumentdocumentelementscrolltopmaleneversignificantlinear zindexeyeswoman shouldfunctionnothenconstmailzindexshowmoreaddeventlistenerclickmostlyyou have1 ifbridesdocwpositionyou wantbut8211 yourdocumentdocumentelementclientwidth 1200estshe alwaysdo notif documentdocumentelementscrolltopfoundif youlinkvaluebeenpeopleimageslookmostlovewifealwaysthat8217sjustmuchconst showmoregirlsfunction event15s linearmail order bridesshowmoreclasslistaddshowmorepartext showmoreinnertext showshowmoreinnertext showwesternmencustside flexibleblockcssowneaseurlwomenknowdocumentcreateelementspan showmoreclasslistaddshowmorepartextlistitem unlistitems0 listitemstyledisplaytypelistitem listitems0partnermeet russianfunction event eventpreventdefaultfindunlistitemsforeachlistitem if listitemblockelsewhichparamssplittestletwayyou shouldrightthemsplittestattractiveurlparam

Longtail Keyword Density for Bestrussianbrides.net

KeywordsOccurences
const showmore documentcreateelementspan6
showmore documentcreateelementspan showmoreclasslistaddshow-more-par-text6
documentcreateelementspan showmoreclasslistaddshow-more-par-text showmoreinnertext6
showmoreclasslistaddshow-more-par-text showmoreinnertext show6
showmoreinnertext show more6
if documentdocumentelementclientwidth 12004
listitemstyledisplay none const4
listitem unlistitems0 listitemstyledisplay4
if listitem unlistitems04
unlistitemsforeachlistitem if listitem4
none const showmore4
if listitem listitems04
listitem listitems0 listitemstyledisplay4
listitemsforeachlistitem if listitem4
get to know4
mail order brides3
function event eventpreventdefault3
transition transform 15s3
transform 15s linear3
15s linear z-index3
russian women37
russian girls10
russian woman9
if you9
if listitem8
jquerydocumentreadyfunction function7
does not7
if documentdocumentelementclientwidth7
function event6
documentcreateelementspan showmoreclasslistaddshow-more-par-text6
showmoreclasslistaddshow-more-par-text showmoreinnertext6
showmoreinnertext show6
show more6
showmoreaddeventlistenerclick function6
showmore documentcreateelementspan6
const showmore6
you have5
you want5
documentdocumentelementclientwidth 12005
do not5
listitemsforeachlistitem if4
listitem listitems04
listitems0 listitemstyledisplay4
if listtextcontentlength4
listitemstyledisplay none4
none const4
showmorestyledisplay none4
unlistitemsforeachlistitem if4
listitem unlistitems04
unlistitems0 listitemstyledisplay4
not have4
she always4
russian bride4
mail order4
women often4
you should4
else if4
cust-side flexible-blockcss3
15s linear3
transform 15s3
transition transform3
if documentdocumentelementscrolltop3
order brides3
event eventpreventdefault3
1 if3
z-index 5003
ease opacity3
woman should3
you can3
can not3
8211 your3
many men3
meet russian3
dating service3
linear z-index3
russian89
if56
women51
const45
function40
you38
not30
let24
have24
her23
their19
also18
they18
but17
she17
woman16
more16
can15
very14
russia14
many14
014
girls13
so13
jquerydocumentreadyfunction13
111
linkvalue11
man11
should11
find10
your10
want10
has10
men10
documentdocumentelementclientwidth10
dream9
them9
does9
always9
do9
there8
listitemstyledisplay8
often8
listitem8
know8
none8
show8
28
course7
transform7
most7
dating7
lot7
marriage7
showmoreinnertext6
showmoreaddeventlistenerclick6
event6
showmoreclasslistaddshow-more-par-text6
documentcreateelementspan6
36
because6
46
urlparam6
good6
opacity6
order6
else6
new6
that8217s6
get6
all6
min6
showmore6
look6
therefore5
some5
partner5
which5
feminine5
russians5
meet5
flowers5
important5
western5
bride5
z-index5
transition5
usually5
take5
continue5
lists5
linkkey5
settimeoutfunction5
55
flex5
max4
unlistitems04
listitemsforeachlistitem4
unlistitemsforeachlistitem4
showmorestyledisplay4
he4
flexibleblock4
------------------------------4
options4
no4
listitems04
str4
after4
listqueryselectorallli4
listtextcontentlength4
substr4
lastlink4
hair4
split-test4
url4
beautiful4
forms4
well4
success4
themselves4
asian4
observer4
top4
ref4
romantic4
like4
make4
even4
just4
perfect4
we4
ease4
up4
documentdocumentelementscrolltop4
center4
marry4
brides4
eventpreventdefault4
really4
yourself4
mail4
false3
pcversion3
attractive3
add3
among3
key3
013
63
linear3
block3
meetings3
15s3
paramssplittestlet3
data3
flexibleblockcss3
docw3
73
null3
type3
position3
flexible-blockcss3
olfindlifirst-child3
sum3
best3
bst3
documentqueryselectorallhead-lock3
est3
quiz3
cover3
cust-side3
would3
world3
significant3
mostly3
eyes3
small3
something3
see3
male3
impression3
special3
beauty3
found3
expect3
addition3
love3
shows3
put3
car3
time3
care3
day3
already3
least3
people3
first3
right3
never3
only3
start3
said3
service3
big3
romance3
furthermore3
much3
together3
been3
then3
westernnbsp3
foreigners3
own3
these3
wife3
way3
images3

Who hosts Bestrussianbrides.net?

Bestrussianbrides.net Hosting Provider Information

Hosted IP Address:172.67.199.84
Hosted Hostname:172.67.199.84
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
T-Mobile USA, Inc.
1.4318%

HTTP Header Analysis for Bestrussianbrides.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sun, 18 Oct 2020 16:00:46 GMT
Content-Type: text/html; charset=iso-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
Location: https://bestrussianbrides.net/
CF-Cache-Status: DYNAMIC
cf-request-id: 05de0a31b30000069a2ca7c000000001
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?lkg-colo=21&lkg-time=1603036847"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5e437962bbe2069a-LHR

Bestrussianbrides.net Domain Nameserver Information

HostIP AddressCountry
doug.ns.cloudflare.com 108.162.193.159
sima.ns.cloudflare.com 173.245.58.222


Need to find out who hosts Bestrussianbrides.net?


Domain Registration (WhoIs) information for Bestrussianbrides.net

 Domain name: bestrussianbrides.net
Registry Domain ID: 2409625794_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2020-06-05T05:59:17.98Z
Creation Date: 2019-07-05T08:19:43.00Z
Registrar Registration Expiration Date: 2021-07-05T08:19:43.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code:
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID:
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code:
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: Login to show email
Tech ID:
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code:
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: Login to show email
Server: doug.ns.cloudflare.com
Name Server: sima.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-10-18T01:00:54.19Z

Websites with Similar Names

Bestr.net
bestr.net
Bestr6youtuber.com
bestr6youtuber.com
Bestr8.online
Build a Free Website - Sitebeat
Bestra.ee
Steel Products and Structures | Vimana OÜ
Bestra.us
bestra.us - Registered at Namecheap.com

Recently Updated Websites

Sheeek.com (4 seconds ago.)Maisondhotesladomitia.com (5 seconds ago.)Mutaleya.com (5 seconds ago.)Sketchresponsibly.com (6 seconds ago.)Oghype.com (6 seconds ago.)Cudenveradmissions.org (7 seconds ago.)Ringateacher.com (7 seconds ago.)Raynauds.biz (7 seconds ago.)Hzgnzs.com (8 seconds ago.)Taylorannedesigns.net (9 seconds ago.)Zipseriale.blogspot.com (10 seconds ago.)Kotareyog.com (12 seconds ago.)Farrandwild.com (13 seconds ago.)Szcx21.com (13 seconds ago.)913healthexperts.com (14 seconds ago.)Knowledgebusinesspro.com (15 seconds ago.)Bridgemorvillage.com (16 seconds ago.)Jomkiss5.com (17 seconds ago.)Whenitrainsitpars.com (18 seconds ago.)Salarymanshock.com (18 seconds ago.)Imwithgandhi.com (19 seconds ago.)Bits.netbeans.org (20 seconds ago.)Fast-furniture-transport-in-riyadh.com (20 seconds ago.)Kaleidodesign.net (20 seconds ago.)Contentment.info (23 seconds ago.)Autoescuelasnumero1.com (23 seconds ago.)Gx0855.com (24 seconds ago.)Q9587.com (25 seconds ago.)Donemail.ru (26 seconds ago.)Salernobeachrestaurant.net (27 seconds ago.)

Recently Searched Keywords

американская компания планирует заняться строительством платных дорог в узбекистане (2 seconds ago.)ffb-id-1v78bdom ffb-h2-1 beforeffb-id-1v78bdom (5 seconds ago.)sporting events (5 seconds ago.)mybest (5 seconds ago.)satılık arsa lefkoşa (9 seconds ago.)những tác hại của việc quan hệ tình dục nhiều lần trong một đêm (10 seconds ago.)1xslot9 (11 seconds ago.)1xslot9 (12 seconds ago.)军媒 (12 seconds ago.)funny kittens (14 seconds ago.)regular localmontserrat-regular (16 seconds ago.)kittens humor (16 seconds ago.)маслкары (19 seconds ago.)social security disability calculator (19 seconds ago.)canillordhuffcombrn address (20 seconds ago.)offering to the storm netflix (23 seconds ago.)контекстная реклама в пс (23 seconds ago.)make donate options (23 seconds ago.)2015-08-05 spelarpresentation lördag 15 aug (25 seconds ago.)muhammed enisokullarin tüm ihtiyaçlari karşilandi (26 seconds ago.)nhng chuyn du (26 seconds ago.)хлопковые худи (27 seconds ago.)funny cat memes (29 seconds ago.)7-10 working (30 seconds ago.)lan detaylar blblzade (30 seconds ago.)funny cat (30 seconds ago.)восемьдесят шесть ~ (21:30) (31 seconds ago.)panel printer (32 seconds ago.)funny cat (32 seconds ago.)美痴女~いかがわしい業務命令 (33 seconds ago.)