Bestsale de webshop voor kookartikelen zoals demeyere le creuset point virgule en alle njam artikelen aan lage promotie prijzen. ook elektro en doe het zelf artikelen maar ook zwilling chroma en de buyer

Safety: Low trust score
Year Founded: 2012
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Array



Domain summary

Last updated
2021-04-10
Domain label
bestsale
Domain extension
be
Domain registered:
2012-06-20
Domain updated:
2021-04-10
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is bestsale.be ranked relative to other sites:

Percentage of visits to bestsale.be from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Bestsale.be registered?
A: Bestsale.be was registered 8 years, 9 months, 3 weeks, 3 days, 23 hours, 35 minutes, 55 seconds ago on Wednesday, June 20, 2012.
Q: When was the WHOIS for Bestsale.be last updated?
A: The WHOIS entry was last updated 4 days, 23 hours, 35 minutes, 55 seconds ago on Saturday, April 10, 2021.
Q: What are Bestsale.be's nameservers?
A: DNS for Bestsale.be is provided by the following nameservers:
  • www.dnsbelgium.be
  • ns3.hosted-power.com
  • ns2.hosted-power.com
  • ns1.hosted-power.com
Q: Who is the registrar for the Bestsale.be domain?
A: The domain has been registered at DNS Belgium.
Q: What is the traffic rank for Bestsale.be?
A: Bestsale.be has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Bestsale.be each day?
A: Bestsale.be receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Bestsale.be resolve to?
A: Bestsale.be resolves to the IPv4 address 94.237.42.178.
Q: In what country are Bestsale.be servers located in?
A: Bestsale.be has servers located in the Netherlands.
Q: What webserver software does Bestsale.be use?
A: Bestsale.be is powered by Apache webserver.
Q: Who hosts Bestsale.be?
A: Bestsale.be is hosted by UpCloud Ltd in North Holland, Badhoevedorp, Netherlands, 1171.
Q: How much is Bestsale.be worth?
A: Bestsale.be has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Bestsale.be Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Bestsale.be Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Bestsale.be

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

4 :
  1. Mijn account
  2. Klantenservice
  3. Informatie
  4. Extra

H4 Headings

1 :
  1. Winkelwagen

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

102 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-8833820-13

Links - Internal

391:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Bestsale.be

superpromotiessupercontact56421 maxbirkenstockmet dekselunwautersfaun seulbenjamin tester paris6birkenstock superterresblokclassic autoparfumbirki klompen zwartmijn0900blok 6421 maxatlantisasianavonesuper birki klompenparispos displaysergio herman surfacenaessens pure1700 1700 1700mestdagh sigillataseul monderobertandereaanverlanglijst2pos display ilumspecialiteitenbenjamin ilum1361 max benjaminchromanaessens8maxsurfacebigpannenvan dammeelsesolden tot 55benjamin classicsistema11opmestdaghfallrvssergioilum un seulpottenpannengreen eggchromasetbirki klompen0900 0900buyergrelle9zwillingtot 55fall geurdiffuserkokenpascale naessens purehetmetrefclassicdesign0le grelle terressigillata24cmmax benjamin ilum1700 1700apollokookpan898 max benjaminampgeurdiffuser1361 maxautoparfum navullingbunmeijeeggbenjamin classic autoparfumpawsonboonbrupannensolden totalu progomessen 301 messentester pariscmposclassic autoparfum navullingcm refeggchromaseultotleveringbestellenfileermesmessengeurkaarspro0pxgreendamme6421 max benjaminpointvirguleles4pascalewinkelwagenperfectveldejohn pawsonseraxdemeyerenavullingautoparfumbenjamin ilum ungreen eggfall geurkaarsherman301 messen designpascale naessensbig green egg12super birkiresto1prijs898 maxmax benjamin tester6044 4835benjamin pos displaybastardcreusetalugautierbig greenmondmasker prijsl demeyerekookpotstaubherman surfacevan7mondetruelegiacomazzamondmaskerle creuseteensoldenmerken3deligofficemesbenjaminafhalenkookpotten leftheight3kookpot demeyereglobalmax benjaminstoofpandisplayle grellediamkookpottenmijn accountilum unklompen zwarttwinkeirsebilckverzendkostenwokbenjamin posbirkileveringenilumdesign by faun seul monde pottenpannenjohnkoksmes officemespurebirkenstock super birkibenjamin testerdeksel diamtesterklompengrelle terresmax benjamin classic10onderdelenvoorvan de veldeblok 6421max benjamin pos20cmkoksmesmessen designdekseldisplay ilum13zwarthomenieuw0900 0900 0900varvelde perfectaccountsergio herman

Longtail Keyword Density for Bestsale.be

KeywordsOccurences
big green egg10
max benjamin tester9
6421 max benjamin7
blok 6421 max7
benjamin pos display7
max benjamin pos7
benjamin tester paris6
pos display ilum6
un seul monde5
ilum un seul5
1361 max benjamin5
898 max benjamin4
301 messen design4
solden tot -554
0900 0900 09004
sergio herman surface4
pascale naessens pure4
van de velde4
le grelle terres4
design by fa4
1700 1700 17003
birki klompen zwart3
super birki klompen3
birkenstock super birki3
max benjamin ilum3
benjamin ilum un3
max benjamin classic3
benjamin classic autoparfum3
classic autoparfum navulling3
max benjamin24
--- demeyere19
le creuset15
big green11
green egg10
benjamin tester9
blok 64217
6421 max7
pos display7
benjamin pos7
messen ---6
naessens pure6
display ilum6
herman surface6
tester paris6
0900 09005
john pawson5
1361 max5
seul monde5
ilum un5
un seul5
898 max4
1700 17004
tot -554
solden tot4
pascale naessens4
le grelle4
mestdagh sigillata4
velde perfect4
sergio herman4
grelle terres4
mijn account4
met deksel4
van damme4
messen design4
301 messen4
alu pro3
green eggchroma3
benjamin ilum3
benjamin classic3
classic autoparfum3
koksmes officemes3
fall geurkaars3
fall geurdiffuser3
kookpot demeyere3
kookpotten ---3
--- pottenpannen3
6044 48353
klompen zwart3
birki klompen3
super birki3
birkenstock super3
mondmasker prijs3
deksel diam3
cm ref3
autoparfum navulling3
---106
demeyere53
max24
benjamin24
van24
le19
messen17
creuset15
zwilling15
atlantis14
green13
big11
ilum10
het10
sistema10
egg10
met10
tester9
voor9
deksel8
pannen8
naessens8
herman8
kookpotten7
07
blok7
john7
pure7
amp7
bastard7
pos7
display7
pottenpannen7
twin6
classic6
cm6
kookpot6
les6
account6
fall6
geurkaars6
09006
geurdiffuser6
surface6
paris6
tot6
alu5
un5
15
monde5
set5
chroma5
wok5
buyer5
specialiteiten5
resto5
pawson5
apollo5
20cm5
25
koken5
serax5
seul5
leftheight4
true4
34
koksmes4
fileermes4
l4
leveringen4
zwart4
afhalen4
0px4
mijn4
bunmei4
mestdagh4
gautier4
keirsebilck4
perfect4
velde4
boon4
terres4
grelle4
giacomazza4
sergio4
damme4
wauters4
fa4
design4
44
54
solden4
64
sigillata4
navone4
global4
pro4
merken4
onderdelen4
pascale4
officemes3
robert3
op3
73
ref3
point-virgule3
diam3
superpromoties3
go3
rvs3
eggchroma3
staub3
3-delig3
winkelwagen3
een3
autoparfum3
navulling3
83
var3
bestellen3
asia3
kookpan3
24cm3
super3
andere3
contact3
stoofpan3
home3
brupannen3
93
mondmasker3
prijs3
birkenstock3
birki3
aan3
klompen3
103
113
verzendkosten3
levering3
123
else3
nieuw3
je3
133
verlanglijst3

Who hosts Bestsale.be?

Bestsale.be Hosting Provider Information

Hosted IP Address:94.237.42.178
Hosted Hostname:web.bestsale.be
Service Provider:UpCloud Ltd
Hosted Country:NetherlandsNL
Location Latitude:52.3388
Location Longitude:4.7827
Webserver Software:Apache

Is "UpCloud Ltd" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
UpCloud Ltd
0.0179%

HTTP Header Analysis for Bestsale.be

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 10 Apr 2021 15:04:35 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip
Vary: Accept-Encoding,User-Agent
X-Frame-Options: SAMEORIGIN
Upgrade: h2,h2c
Connection: Upgrade
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8

Bestsale.be Domain Nameserver Information

HostIP AddressCountry
www.dnsbelgium.be 107.154.248.139
ns3.hosted-power.com 94.237.46.109
ns2.hosted-power.com 94.237.94.82
ns1.hosted-power.com 31.3.98.171


Need to find out who hosts Bestsale.be?


Domain Registration (WhoIs) information for Bestsale.be

 % .be Whois Server 6.1
%
% The WHOIS service offered by DNS Belgium and the access to the records in the DNS Belgium
% WHOIS database are provided for information purposes only. It allows
% persons to check whether a specific domain name is still available or not
% and to obtain information related to the registration records of
% existing domain names.
%
% DNS Belgium cannot, under any circumstances, be held liable where the stored
% information would prove to be incomplete or inaccurate in any sense.
%
% By submitting a query you agree not to use the information made available
% to:
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or otherwise;
% - target advertising in any possible way;
% - to cause nuisance in any possible way to the domain name holders by sending
% messages to them (whether by automated, electronic processes capable of
% enabling high volumes or other possible means).
%
% Without prejudice to the above, it is explicitly forbidden to extract, copy
% and/or use or re-utilise in any form and by any means (electronically or
% not) the whole or a quantitatively or qualitatively substantial part
% of the contents of the WHOIS database without prior and explicit permission
% by DNS Belgium, nor in any attempt thereof, to apply automated, electronic
% processes to DNS Belgium (or its systems).
%
% You agree that any reproduction and/or transmission of data for commercial
% purposes will always be considered as the extraction of a substantial
% part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept that
% DNS Belgium can take measures to limit the use of its whois services in order to
% protect the privacy of its registrants or the integrity of the database.
%

Domain: bestsale.be
Status: NOT AVAILABLE
Registered: Wed Jun 20 2012

Registrant:
Not shown, please visit www.dnsbelgium.be for webbased whois.

Registrar Technical Contacts:

Registrar:
Name: Hosted Power
Website: https://www.hosted-power.com/

Nameservers:
ns3.hosted-power.com
ns2.hosted-power.com
ns1.hosted-power.com

Keys:

Flags:

Please visit www.dnsbelgium.be for more info.

Websites with Similar Names

Bests-deals-dicounts.com
bests-deals-dicounts.com is registered with Mailchimp
Bests-fiends.com
BEST-FIENDS - Главная
Bests-online24.info
Срок регистрации домена bests-online24.info истёк
Bests-panish.site
Bests-panish - Курсы испанского языка
Bests-pop.pro
403 Forbidden
Bests-potolki-sevastopol.site
Домен не прилинкован ни к одной из директорий на сервере!
Bests-potolkis-sevastopol.site
Домен не прилинкован ни к одной из директорий на сервере!
Bests-potolok-sevastopol.site
Домен не прилинкован ни к одной из директорий на сервере!

Recently Updated Websites

Elitehomes.live (1 second ago.)Gozync.com (1 second ago.)Moldovalive.com (2 seconds ago.)Ballsleroux.com (2 seconds ago.)Whitef.com (2 seconds ago.)Gnum.biz (2 seconds ago.)Gidgesagui.com (2 seconds ago.)Ttlpakjapple.store (2 seconds ago.)Scalinguphub.com (2 seconds ago.)Babarell.net (2 seconds ago.)Arterosa.com (2 seconds ago.)Ruspromimport.ru (3 seconds ago.)Whatoiljobs.com (3 seconds ago.)Mycr.de (3 seconds ago.)Guardian8oil.com (3 seconds ago.)Deercreeklockoutspecialist.com (3 seconds ago.)Mydjdave.net (3 seconds ago.)Castilwilliamsbankruptcyattorney.com (3 seconds ago.)Www38668.com (3 seconds ago.)Scottsackett.com (3 seconds ago.)Capciudaddemurcia.com (3 seconds ago.)Isadoradolls.com (4 seconds ago.)Buildingscienceservices.com (4 seconds ago.)Onfighting.net (4 seconds ago.)Billiebangco.com (4 seconds ago.)Biocleanamericaservices.com (4 seconds ago.)Theprivacyexperience.com (4 seconds ago.)Noxplushotel.com (4 seconds ago.)Codequora.com (4 seconds ago.)Playmakerdev.com (4 seconds ago.)

Recently Searched Keywords

connected car plans (2 seconds ago.)72787 (3 seconds ago.)minus (4 seconds ago.)acompanhantes (4 seconds ago.)replica gucci (6 seconds ago.)you all (8 seconds ago.)ultimo (9 seconds ago.)【新浪新闻】引用中藏联盟近期订单... (9 seconds ago.)enjoy a romantic (9 seconds ago.)rss india net worth (10 seconds ago.)yahoo policy (10 seconds ago.)ones marshbird (11 seconds ago.)statistical horizons coupon code (13 seconds ago.)1900 dcouvrir (14 seconds ago.)dr. karen todd (16 seconds ago.)paracord con (17 seconds ago.)6:58 شاب جامعي يطلع زبه السمين لصاحبته المزة تسخن عليه تلحسه و تتناك (19 seconds ago.)rabbit zodiac personality (20 seconds ago.)build brand awareness (21 seconds ago.)liveaboards (22 seconds ago.)fetish and niche membership listing (25 seconds ago.)why are brits obsessed with the same four vegetables (26 seconds ago.)southern minnesota regional legal services (26 seconds ago.)ffffff text-decoration (27 seconds ago.)tweet tweet (28 seconds ago.)okay (28 seconds ago.)hải âu ha 1800 (29 seconds ago.)servicenow logo image (30 seconds ago.)indian air force (30 seconds ago.)etpbfullwidthheader1 (31 seconds ago.)