Bowling Green State University

Safety: High trust score
Year Founded: 1986
Global Traffic Rank: 7,766
Estimated Worth: $2,080,080

Bowling Green State University is a top public university in Ohio and nationwide with quality undergraduate and graduate academic programs that lead to career success



Domain summary

Last updated
2021-09-26
Domain label
bgsu
Domain extension
edu
Domain registered:
1986-06-02
Domain updated:
2021-06-08
Global Traffic Rank
7,766
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$2,080,080
Estimated daily income
$1,926
Estimated monthly income
$58,583

Frequently Asked Questions (FAQ)

Q: When was Bgsu.edu registered?
A: Bgsu.edu was registered 35 years, 7 months, 3 weeks, 5 hours, 7 minutes, 16 seconds ago on Monday, June 2, 1986.
Q: When was the WHOIS for Bgsu.edu last updated?
A: The WHOIS entry was last updated 7 months, 2 weeks, 1 day, 5 hours, 7 minutes, 16 seconds ago on Tuesday, June 8, 2021.
Q: What are Bgsu.edu's nameservers?
A: DNS for Bgsu.edu is provided by the following nameservers:
  • ns7.oar.net
  • ns7.oar.net
  • ns6.oar.net
  • ns4.oar.net
  • ns4.oar.net
  • ns6.oar.net
  • ns5.oar.net
  • ns5.oar.net
Q: Who is the registrar for the Bgsu.edu domain?
A: The domain has been registered at EDUCASE.
Q: What is the traffic rank for Bgsu.edu?
A: Bgsu.edu ranks 7,766 globally on Alexa. Bgsu.edu has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Bgsu.edu each day?
A: Bgsu.edu receives approximately 240,793 visitors and 1,926,344 page impressions per day.
Q: What IP address does Bgsu.edu resolve to?
A: Bgsu.edu resolves to the IPv4 address 129.1.11.8.
Q: In what country are Bgsu.edu servers located in?
A: Bgsu.edu has servers located in the United States.
Q: What webserver software does Bgsu.edu use?
A: Bgsu.edu is powered by webserver.
Q: Who hosts Bgsu.edu?
A: Bgsu.edu is hosted by BGSU in Ohio, Bowling Green, United States, 43403.
Q: How much is Bgsu.edu worth?
A: Bgsu.edu has an estimated worth of $2,080,080. An average daily income of approximately $1,926, which is roughly $58,583 per month.

Bgsu.edu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Bgsu.edu Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Bgsu.edu

H1 Headings

1 :
  1. Bowling Green State University

H2 Headings

4 :
  1. Falcons soar!
  2. Explore graduate programs at BGSU
  3. News
  4. Earn a Graduate Degree Your Way

H3 Headings

9 :
  1. A trailblazer for diversity and belonging: BGSU honors Dr. Robert L. Perry ’59, ’65
  2. A decade of the Wolfe Center for the Arts, in photos
  3. BGSU inducts 2021 Class of the Academy of Distinguished Alumni
  4. Level
  5. Program Clusters
  6. All Graduate Programs
  7. Programs for Working Professionals
  8. Accelerated Bachelor's to Master's
  9. 100% Online Programs

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

200 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

434:

Links - Internal (nofollow)

0:

Links - Outbound

40:

Links - Outbound (nofollow)

0:

Keyword Cloud for Bgsu.edu

students interestedreceiveb mconnectionsdeveloping the skillsprograms beforeteach gradesnotparkingcaresocial workalumnihuman developmenthaveprograms unknown majorwritingsystemspecializingafricana studiesteacher the adolescenceculture studiesdual major majorsenvironmental healthsoccermarketing cognatemajor provideslanguage education preparesforensic sciencelabm bachelor premajorscholarshipsmusicalteacherskills and techniqueschealthadultprogram prepares graduateshhs hshometheaterbgsuscience f ocobyoung adult teachingfieldyouthlanguage licensedvisualwideproductteachingvarious programs beforefairmediapreparetherapym biologyimpactclassacademiceconomicsorientationprograms minortrackconsumer sciencesvarietyprovideshhsmajor majorsathleticsexplore variouspublic relationsacademymakespecificcouncilprogram f olawpreprofessional programsolmenugrouparts f obachelor the adolescencetheatre majorsse majorslicensingdegree712militaryinvolvedmathorganizationsrequired for theiraz linkssupportaccessibility servicestightenprograms bmetheatre receivecultures foreignscreen2split50splitcontenttourismlicense in integratedreceive a solidgreen state universityinteractiveticketsclustersstudent servicesb m mcsetstate universityspecialization prepares studentsstudieshealthcarecommons undergraduatedropdownmenuendorsementcareersenglishdevelopmentamericanspecific areastudents who wishnationallycas minormmmenubminor bme bachelorfreshmanfamily and consumerapplicationb m etcombinestrainingyouprograms caslanguagesdividgcse gsccontrolsearchboxonlyandorcontainer divabroadagencieslinksbackgroundhuman servicescomputer scienced mopacity 10campaigninterestsamp partnershipspolicyprogramcoursesareafashion merchandisingbusiness f ographicoccupationaldesign f omerchandisingmarine biologycenterreportmusical artsminor bachelorpharmacynbspprepares studentsimportantcomputingflexibledifferentafricanabgsusm cviewdeciding studentyourforeignprograms edhdphysical educationarts amphsnumber of optionsculturesdesignedundecideduservisithonors2solidleadershipitalianmajors specializing10pxbefore choosingmaxwidthlanguagem mcset majorschemistry educationfashionsocialmostcas eyoliberal artscas eyo enrollschoolsbachelor majorsspecialization preparescareer center centermajors ampmvideom majorsresearchbachelor cmaprocessesaccreditedhuman resourcesbachelor cobpaddingdobody tightengsccontrolsearchboxonlycrosscollectionsspecializationseducationprograms bme bachelorworld musicminoro d marea of interestonecas bachelorfeesfamily ampgrades 712dincludingmusical theatrechemistry majorf ocalendarengineering farts minorsalessoundcma the musiccovid19excellentdigital artscollege of businessinterdisciplinaryconsidereight languagesopportunitybme bachelorlibraryitsprograms before choosinginternationalgermanconstructioninteresttheatre fstudentarts management1thinkingresearch ampopacity 0american culture studiesallorussian and eastpoliticstypeworld languagespreparesarts educationprofessionalcenter centersciences funknownuseunknown major eyowish to explorephysicssportecologyvirtualm et majorsampclusters majorsminor bmefine artsasian languagessciencesvarious programsdataoffers a uniquefacultyprepharmacybutneurosciencemajors amp programsnewsection displayb m edhdimagewebuniversityfinancial aidfieldsphysics education facademy of distinguishedtailored to theirdistinguished alumniarts fbeforefalcon outfittersemphasizesspecialdiversity and belonginghealth and humanlegal servicessoftware engineeringpublicwestatepremajor dual majorchoosingsshspmour0uniqueprintctaaestudio artsecurityohio campusopacityparent familyhumanitiesadvertisingconservation sciencestudyexperiencenationalprogram fbasketballb m majorsmajors and programsminor bachelor clustersvariousplananyappliedtutoringlearning commonsmajorsplanningchemistry education finformationstudent employmentfalconsstudents for careersforeign languagesinvestigationenrollliberalgainacademicsadult aya programm c bprograms ampcmabasketball crossmarketing f ocognatestatesrecordsnewsclass searchthrougheconomicethnic3dgeographysciences f oexerciseindividualapplied engineeringbmeregistration ampprovidearchitecture and environmentalpeopleoffers a numberrecognitionmathematicsresourcetechniques requiredgraduate programslife sciencesgerman russianff7300dual majorphysics educationnew studentasian studiesearthneedsneededregistration amp recordsm onlinemobilenavlife sciencequalityfuturebusinessmastersprogram providescommonsprepares graduatesliberal arts foundationc bbowlingeventssystemslicense in lifethemcriminaladult ayacassystems f ofirelandstighten container divgreen statetutoringlearningbroadjapanesetechnology ftuitionpleasebelongingfees visitgerontologyadult teaching licenseteaching onespanishrankedarts foundationcollege creditmarketing fresorteducation fbachelor senursingstudent connectionscas bachelor hlicprecollegemedicinestudionewsection display nonesolid liberalspecialisteyoengineering technology foptometryfamily and newcatalogonline majorsadolescence to youngbachelor hhsmandarin chineseearnstudent programprograms cas minormanagement f odata sciencebme bachelor cobbowling greenadult teachingamerican cultureprgmnavminor bachelor sespanfirstlinescience majorcomputer programmingwhile developingearth sciences educationlearnstudents to workunknown major caspppinternational studentpositioncountryb m minorscience fadmissionsazm etforensic chemistrymulticulturalpartnershipsbachelor premajorprovides studentscollege credit pluspoliticalrnlegalenvironmentalcompositioneducation and developmentsocietystudentsworkfinancialapplied designb m onlineyounginterest in theatreapplyayadegree programearth sciencesmcset majorsd m cthereaccessibilitydropdownmenu olmenugroupwellcustomerprepare studentsworkforce educationhealth scienceprovostsupply chainbachelor of sciencepreparationhelpadvisingmajor cas eyobusiness educationtheatre majors specializingmindtheir specific areaexploreforensicsmygovernmentbgsu offersm edhd bachelorstudents who wantf o dgraduatesdesignprograms bachelor hhsbgsu firelandschoiceprehealthfamilymarketingtighten containerresourcesprograms unknownamp programsgraduateeducation prepares studentspnetworkstafflearning communitiescontactm bachelorprograms edhd bachelorviewonlygiftcareer teaching onebachelorscontact uschemistryart teacherchoosing a majorc b meducation preparesh2engineering technologyhalladministrationlongtermminor edhdperformingyearsearth scienceengagementsocial sciencesscholarshipmorecareer centercredit pluscampaign for bgsustudies f obestpopular culturemargindepartmentenvironmentaidmicrobiologym arts theatrearchitecturecomputerresource centertechnical theatremajortailored20pxdisciplineanalysis0pxpredentistrybiology f otakem mcset4business fnewstitlealsooperationslanguages licensed4sdisplay nonemake a giftedhd bachelor teacherpopularlicensedgolfpresidentregistrationschoolnutritiononlineart educationdatabasespremajorgeneraltheatrefactionbachelor clustersprogramsbodydeciding student programcommunitiestuition and feesdigitalwithinserviceknowledgeeducation abroadprogrammingstate universitysforensic biologybfasportsobtain an adolescenceregionallanguage educationgraduates to teachrequiredsupplybachelor sshspmtutoringlearning commons undergraduatebachelor hhs sshspmcross countryhighconsumerminor bachelor hlicaffairsstrategicaccountingemploymentjournalismboardfundamentalsrangestudies majormedia maxwidthindividualsengineering f oschmidthorstethnic studiesyoung adult ayadirectorsdemandlibrariesbachelor ctaaefoundation while developingusmarinearts majorsastronomyart historyinformation systemscontainer div texttitlecommunicationcolor ff7300b m bachelorareasmajor eyobachelors degreegiveulcas preprofessional programscalendar falconbody tighten containersixbowling green stateinsurancefindfoundationquestionspreprofessional programassistantopendistinguishednoneprograms bachelorschmidthorst collegem edhdfacultystaffeast asianuser experienceedhd bachelormanyundergraduatenewunitedplusm minor bachelorexplore various programsjapanese languagearts amp sciencesskillsspansecondlinecounselingevents calendarprograms bachelor ctaaesciences education fprogram preparesppp bachelorcanvarboard of directorsprograms cas bacheloremphasisasianchainchinesewant to studytechnologyamp recordssecoreworldartssafetyeight languages licensedworkforcescienceinfinitecomputational datadisplayairportalumni councilohiominor casbachelor hhs hsgraphic designbehaviorpsychologymultidisciplinaryjazzlifeaviationsearchdisordershistoryprograms businessstatisticstextmethodsadministrativebachelor premajor duallanguages and culturesliteratureyoung adultprograms tutoringlearningm artsspecializationsoftwaregeologyamp sciencesconservationcjmpreveterinarym online majorswriting programlongterm carecas hliccoursemedicalcommunityyou cancontainerlicensecolorotherhelp youauditingbachelor teachershouldcampusmobilem arts majorsperformanceet majorsnew student connectionsprograms tutoringlearning commonshlicenvironmental designhumancenter for familyalliedacadprograms minor bachelorarts theatresolid liberal artsfilmadolescenceopacity0sshspm the bachelormanufacturingrelationsintegratedproductiontechnology supportmanagement fmanagementdiversitycomputationalallied healthfalconwayscultures foreign languagessciences bachelorm minorgreeneastscience in nursingcollegesmajor and receivepremedicinewishtechnology architecturebiology ftransfernewstitle h2programs amp partnershipsrussianhoursmajor casactuarialcolorfffcreativeparentstylingbasketball cross countryhealth carenecessaryoptions for studentsofficespreprofessionaldivculturedevelopinghhs sshspmphilosophyobtainlatinmcsetcas minor bachelornumberb m artseventcourseworkclusters setheatre f ounknown majorwhileindividualizedinternshipsfinegradesjusticeacrossjobsuniversitysengineeringlargestprogram prepares studentspayaya program preparesteachservicesdiv text3major ohioprofessionalscreditteach grades 712collegefocusesdecidingcriticaldentalanalyticalundecided majoroptionsgrowingscientistlearningcomputer softwareundecided in artsdesign majorteaching licensebachelorinterestedtechnology f ocedarunderstandingcareeretprograms minor casminor bachelor majorslicense in earthtechniquesfinancebachelor bmelikecriminal justicescience educationdividgcsespecialization is designeddevelopo dsuccessfulcommunicationssuchfrenchphysicalviewonly newsection displayprograms bachelor cmaactuarial scienceoffersprograms minor bmebusiness systemsadvertising majorbachelor clusters seliberal studieseducation f otechnicalmandarinwantbachelor hlicdirectoryfadeinfadeoutmusiccreateprelawperforming artscas preprofessionalgreen state universitystheir specificdesign feachcurriculumfoundation whilecomputational data sciencewhichtheirstudies fedhdtitle ixbiologyunited statesstagedirectorsystems foutfittersb m biologyrolescompanyamp staffcareer teachingbsneast asian languagespreveterinary medicinearts foundation whilereceive advisingviewonly newsectionrotatebragartminor cas bachelortechnologieseyo enrollsciences educationforensicaya programarts and sciencescorporatelicensurenewsectionindustrydualstate of ohioamp humanixpremajor duallaboratoryeight

Longtail Keyword Density for Bgsu.edu

KeywordsOccurences
majors and programs195
c b m191
f o d191
m c b191
d m c191
o d m191
b m majors63
adolescence to young30
education f o29
b m et28
m et majors26
programs edhd bachelor25
programs cas minor19
b m arts19
cas minor bachelor17
bowling green state16
program prepares graduates15
adult teaching license14
young adult teaching14
obtain an adolescence14
teach grades 7-1214
graduates to teach14
aya program prepares14
young adult aya14
adult aya program14
edhd bachelor teacher14
bme bachelor cob13
b m bachelor13
green state university13
b m minor12
programs cas bachelor11
bachelor of science11
m arts majors11
programs unknown major11
studies f o10
minor bme bachelor10
teacher the adolescence10
science f o9
state of ohio9
programs minor bme9
newsection display none9
view-only newsection display9
education prepares students8
language education prepares8
m minor bachelor8
dual major majors8
management f o8
body tighten container8
tighten container div8
minor bachelor hlic7
bachelor pre-major dual7
pre-major dual major7
college credit plus6
programs bachelor cma6
programs minor cas6
programs minor bachelor6
arts f o6
students for careers6
technology f o6
programs bachelor hhs6
b m online6
b m mcset6
bachelor hhs hs6
m bachelor pre-major6
students who wish5
m mcset majors5
m online majors5
programs bme bachelor5
diversity and belonging5
college of business5
board of directors4
program prepares students4
solid liberal arts4
receive a solid4
theatre majors specializing4
career center center4
arts and sciences4
specialization is designed4
minor bachelor se4
physics education f4
theatre f o4
programs amp partnerships4
students who want4
minor cas bachelor4
center for family4
basketball cross country4
biology f o4
license in life4
license in integrated4
campaign for bgsu4
programs tutoringlearning commons4
tuition and fees4
registration amp records4
liberal arts foundation4
program f o4
career teaching one4
number of options4
sciences f o4
choosing a major4
programs before choosing4
interest in theatre4
area of interest4
various programs before4
their specific area4
explore various programs4
wish to explore4
arts foundation while4
options for students4
required for their4
skills and techniques4
offers a number4
foundation while developing4
b m edhd4
cas bachelor hlic4
tutoringlearning commons undergraduate4
developing the skills4
education and development3
b m biology3
arts amp sciences3
marketing f o3
minor bachelor clusters3
want to study3
unknown major cas3
business f o3
major cas eyo3
sciences education f3
tailored to their3
cas eyo enroll3
earth sciences education3
unknown major eyo3
bachelor the adolescence3
family and consumer3
majors amp programs3
cma the music3
major and receive3
offers a unique3
deciding student program3
eight languages licensed3
green state universitys3
design f o3
health and human3
specialization prepares students3
programs bachelor ctaae3
computational data science3
engineering technology f3
bachelor hhs sshspm3
sshspm the bachelor3
languages and cultures3
cultures foreign languages3
russian and east3
east asian languages3
m edhd bachelor3
architecture and environmental3
undecided in arts3
make a gift3
chemistry education f3
cas pre-professional programs3
family and new3
license in earth3
new student connections3
bachelor clusters se3
academy of distinguished3
m arts theatre3
container div text3
science in nursing3
minor bachelor majors3
students to work3
engineering f o3
systems f o3
american culture studies3
o d191
d m191
m c191
c b191
b m191
f o191
m majors63
programs cas60
minor bachelor41
et majors31
young adult30
edhd bachelor29
education f29
m et28
programs edhd26
programs minor23
programs bachelor22
program prepares20
bowling green20
m arts19
cas minor19
prepares students19
prepares graduates19
bme bachelor19
green state16
bachelor teacher15
cas bachelor15
teach grades14
adult teaching14
computer science14
adult aya14
aya program14
teaching license14
grades 7-1214
display none14
arts majors13
bachelor cob13
m minor13
state university13
m bachelor13
dual major12
major majors12
bachelor hlic11
programs unknown11
minor bme11
unknown major11
bachelor hhs11
career teaching10
studies f10
hhs hs10
bachelor pre-major10
bgsu offers10
bachelor clusters10
newsection display9
view-only newsection9
mcset majors9
science f9
body tighten9
bachelor se9
language education9
liberal arts8
management f8
online majors8
bachelor ctaae8
student services8
bachelor cma8
education prepares8
tighten container8
container div8
college credit8
musical arts7
bachelor majors7
pre-professional program7
programs amp7
pre-major dual7
human services7
forensic chemistry7
title ix7
media max-width7
physics education7
forensic science7
falcon outfitters6
international student6
credit plus6
graphic design6
m online6
tutoringlearning commons6
pre-professional programs6
m mcset6
theatre majors6
opacity 06
minor cas6
chemistry education6
se majors6
graduate programs6
forensic biology6
art history6
asian studies6
technology f6
arts f6
data science5
earth sciences5
bachelor bme5
while developing5
their specific5
criminal justice5
environmental design5
degree program5
business systems5
information systems5
programs bme5
public relations5
engineering technology5
ethnic studies5
health science5
new student5
human development5
physical education5
student employment5
programs tutoringlearning4
life sciences4
life science4
basketball cross4
supply chain4
dropdown-menu olmenu-group4
cross country4
art education4
united states4
calendar falcon4
alumni council4
science major4
arts education4
events calendar4
language licensed4
majors specializing4
resource center4
biology f4
teaching one4
m edhd4
learning communities4
commons undergraduate4
before choosing4
career center4
center center4
programs before4
various programs4
education abroad4
registration amp4
research amp4
amp records4
students interested4
explore various4
fees visit4
program f4
you can4
contact us4
eight languages4
amp staff4
computer software4
amp human4
arts foundation4
software engineering4
family amp4
eyo enroll4
specific area4
musical theatre4
techniques required4
theatre f4
foundation while4
major cas4
sciences education4
culture studies4
opacity 104
ppp bachelor4
color ff73004
science education4
solid liberal4
sciences f4
amp partnerships4
bachelors degree4
health care4
legal services4
undecided major4
consumer sciences3
marine biology3
digital arts3
marketing cognate3
major eyo3
cas eyo3
receive advising3
environmental health3
arts minor3
pre-veterinary medicine3
earth science3
american culture3
business f3
bachelor sshspm3
sciences bachelor3
major provides3
arts management3
technical theatre3
marketing f3
social work3
workforce education3
cas pre-professional3
allied health3
prepare students3
m biology3
conservation science3
long-term care3
world music3
liberal studies3
cas hlic3
clusters majors3
human resources3
africana studies3
ohio campus3
fine arts3
studio art3
social sciences3
applied design3
dividgcse gsc-control-searchbox-only3
div text3
accessibility services3
popular culture3
distinguished alumni3
technology support3
student connections3
parent family3
a-z links3
major ohio3
bgsu firelands3
financial aid3
student program3
deciding student3
writing program3
amp programs3
majors amp3
class search3
applied engineering3
technology architecture3
business education3
schmidthorst college3
amp sciences3
arts amp3
engineering f3
arts theatre3
systems f3
hhs sshspm3
program provides3
actuarial science3
help you3
languages licensed3
mandarin chinese3
japanese language3
asian languages3
east asian3
german russian3
foreign languages3
cultures foreign3
world languages3
provides students3
art teacher3
computer programming3
performing arts3
programs business3
computational data3
specialization prepares3
chemistry major3
clusters se3
advertising major3
studies major3
state universitys3
minor edhd3
fashion merchandising3
design major3
user experience3
design f3
theatre receive3
news-title h23
m385
programs239
majors214
bachelor197
b192
f192
o192
d191
c191
program89
education88
major85
cas84
minor84
students79
science76
amp70
arts66
student58
bgsu57
prepares45
services44
studies43
business40
degree39
center36
management36
ohio35
et34
art34
theatre34
sciences34
young33
edhd33
career33
design32
health32
teaching31
state31
biology30
adolescence30
adult30
forensic29
graduates28
language28
nbsp28
computer27
research27
graduate27
bme26
you26
chemistry23
hlic23
technology23
college22
teacher22
music22
university21
engineering21
hhs21
history21
alumni21
se21
development21
human21
study21
specialization20
bowling20
international20
hs20
green20
skills19
your19
teach19
information19
careers19
life18
their18
media18
offers18
undecided18
digital18
marketing18
online17
none17
screen2split50split-content17
mcset17
one17
cob17
languages17
family17
school16
clusters16
grades16
license16
systems16
obtain16
nursing15
campus15
social15
communication15
libraries15
7-1214
our14
us14
falcon14
aya14
world14
physics14
applied14
display14
environmental14
pre-professional14
prepare13
013
pre-major13
economics13
culture13
public13
dual13
prgmnav13
ctaae12
musical12
eyo12
data12
liberal12
unknown11
medicine11
designed11
opacity11
software11
important11
leadership11
solid11
body11
field11
experience10
all10
events10
search10
calendar10
foundation10
resources10
110
architecture10
undergraduate10
statistics10
asian10
earth10
sshspm10
provides10
mathematics10
production9
physical9
div9
tighten9
high9
work9
insurance9
new9
plus9
options9
credit9
cma9
german9
enroll9
more9
film9
firelands9
newsection9
view-only9
event9
title9
japanese8
catalog8
color8
colleges8
russian8
interest8
best8
course8
french8
bgsus8
bachelors8
cultures8
integrated8
find8
container8
application8
employment8
fashion8
well8
explore8
technical8
care8
math8
library8
receive8
accounting8
want8
creative8
scholarship8
chinese8
licensed8
country7
quality7
relations7
latin7
p7
max-width7
background7
spanish7
interdisciplinary7
scholarships7
sports7
writing7
jazz7
areas7
training7
advertising7
area7
ix7
medical7
academic7
report7
literature7
philosophy7
professionals6
help6
while6
ranked6
schools6
advising6
developing6
composition6
offices6
we6
graphic6
bfa6
earn6
dropdown-menu6
multidisciplinary6
olmenu-group6
astronomy6
commons6
tutoringlearning6
fields6
fadein-fadeout6
marine6
home6
through6
outfitters6
accessibility6
ppp6
psychology6
transfer6
not6
administration6
learn6
directory6
pre-law6
individuals6
databases6
can6
give6
geography6
broad6
staff6
courses6
cjm6
other6
professional6
criminal6
learning6
apply6
therapy6
government6
performance6
communities6
have6
legal6
sport6
growing5
political5
including5
gerontology5
conservation5
various5
take5
emphasizes5
needs5
wish5
community5
before5
forensics5
jobs5
special5
ethnic5
video5
ecology5
assistant5
unique5
geology5
pre-medicine5
web5
visual5
opportunity5
specific5
youth5
techniques5
knowledge5
analysis5
develop5
aviation5
interested5
acad5
justice5
theater5
which5
but5
programming5
law5
consumer5
andor5
infinite5
directors5
faculty5
ways5
my5
news5
within5
contact5
service5
diversity5
financial5
environment5
curriculum5
belonging5
lab5
individual5
planning5
its5
visit5
text5
0px5
margin5
support5
industry5
collections4
provost4
national4
tailored4
agencies4
nationally4
security4
many4
abroad4
thinking4
airport4
popular4
engagement4
economic4
resource4
administrative4
operations4
type4
deciding4
regional4
golf4
eight4
athletics4
soccer4
workforce4
parking4
connections4
hall4
tickets4
specializations4
board4
recognition4
impact4
such4
network4
chain4
supply4
across4
society4
people4
class4
council4
understanding4
make4
wide4
finance4
padding4
affairs4
cross4
united4
licensure4
records4
president4
24
construction4
required4
states4
journalism4
provide4
technologies4
performing4
specializing4
admissions4
plan4
laboratory4
pharmacy4
processes4
tourism4
sales4
fees4
roles4
studio4
orientation4
tuition4
masters4
bsn4
registration4
flexible4
director4
h24
disorders4
basketball4
covid-194
10px4
partnerships4
investigation4
mobile-nav4
needed4
mind4
italian4
core4
34
ff73004
number4
choosing4
universitys4
merchandising4
behavior4
most4
create4
six4
campaign4
pay3
internships3
dental3
pre-college3
also3
interests3
excellent3
pre-dentistry3
do3
image3
general3
exercise3
view3
emphasis3
any3
microbiology3
individualized3
american3
critical3
healthcare3
each3
long-term3
mobile3
use3
policy3
questions3
specialist3
cognate3
auditing3
news-title3
var3
consider3
gain3
academics3
optometry3
choice3
english3
pre-health3
pre-veterinary3
honors3
endorsement3
schmidthorst3
range3
should3
ul3
mm-menu3
demand3
politics3
allied3
occupational3
20px3
analytical3
methods3
africana3
stage3
colorfff3
years3
product3
43
fair3
gsc-control-searchbox-only3
dividgcse3
styling3
interactive3
spanfirstline3
organizations3
military3
multicultural3
computing3
counseling3
safety3
action3
rotate-brag3
like3
nutrition3
resort3
rn3
largest3
3d3
fine3
company3
focuses3
necessary3
cedar3
opacity03
please3
there3
humanities3
communications3
position3
4s3
user3
spansecondline3
future3
hours3
scientist3
a-z3
them3
licensing3
actuarial3
facultystaff3
links3
customer3
accredited3
neuroscience3
parent3
system3
strategic3
freshman3
virtual3
department3
pre-pharmacy3
preparation3
aid3
manufacturing3
different3
successful3
gift3
sound3
open3
fundamentals3
computational3
distinguished3
academy3
falcons3
variety3
track3
corporate3
discipline3
involved3
print3
foreign3
east3
combines3
coursework3
mandarin3

Who hosts Bgsu.edu?

Bgsu.edu Hosting Provider Information

Hosted IP Address:129.1.11.8
Hosted Hostname:websites2.bgsu.edu
Service Provider:BGSU
Hosted Country:United StatesUS
Location Latitude:41.3802
Location Longitude:-83.6316
Webserver Software:Not Applicable

Is "BGSU" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
BGSU
0.0000%

HTTP Header Analysis for Bgsu.edu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 26 Sep 2021 03:02:18 GMT
Content-Type: text/html;charset=utf-8
Content-Length: 55153
Connection: keep-alive
Server: Apache/2.4.6 (Red Hat Enterprise Linux) Communique/4.3.2
X-Dispatcher: dispatcher1useast1
X-Vhost: bgsupublish
X-Content-Type-Options: nosniff
Last-Modified: Sat, 25 Sep 2021 20:28:47 GMT
ETag: "95b67-5ccd7b5ffbf60-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
X-Frame-Options: SAMEORIGIN
Content-Security-Policy: frame-ancestors 'self' https://bgsu.experiencecloud.adobe.com https://experience.adobe.com

Bgsu.edu Domain Nameserver Information

HostIP AddressCountry
ns7.oar.net 206.244.199.2
ns7.oar.net 206.244.199.2
ns6.oar.net 157.134.199.2
ns4.oar.net 199.18.199.2
ns4.oar.net 199.18.199.2
ns6.oar.net 157.134.199.2
ns5.oar.net 199.218.199.2
ns5.oar.net 199.218.199.2


Need to find out who hosts Bgsu.edu?


Domain Registration (WhoIs) information for Bgsu.edu

 This Registry database contains ONLY .EDU domains.
The data in the EDUCAUSE Whois database is provided
by EDUCAUSE for information purposes in order to
assist in the process of obtaining information about
or related to .edu domain registration records.

The EDUCAUSE Whois database is authoritative for the
.EDU domain.

A Web interface for the .EDU EDUCAUSE Whois Server is
available at: http://whois.educause.edu

By submitting a Whois query, you agree that this information
will not be used to allow, enable, or otherwise support
the transmission of unsolicited commercial advertising or
solicitations via e-mail. The use of electronic processes to
harvest information from this server is generally prohibited
except as reasonably necessary to register or modify .edu
domain names.

-------------------------------------------------------------

Domain Name: BGSU.EDU

Registrant:
Bowling Green State University
Information Technology Services
Bowling Green, OH 43403-0125
USA

Administrative Contact:
Domain Admin
Bowling Green State University
Information Technology Services
Bowling Green, OH Login to show email
Contact:

Bowling Green State University
Information Technology Services
Bowling Green, OH Login to show email
Servers:
NS4.BGSU.EDU
NS5.OAR.NET
NS7.OAR.NET
NS6.OAR.NET
NS5.BGSU.EDU
NS4.OAR.NET

Domain record activated: 02-Jun-1986
Domain record last updated: 08-Jun-2021
Domain expires: 31-Jul-2024

Websites with Similar Names

Bgsu-fa.org
Bowling Green State University Faculty Association
Bgsu.edu
Bowling Green State University
Bgsu.hiretouch.com
Bowling Green State University - Job Opportunities
Bgsuart.net
Coming Soon
Bgsuarts.org
The Arts at BGSU
Bgsuclubsports.com
Bowling Green State University Club Sports - Official Athletics Website
Bgsucollab.com
The Collab Lab
Bgsudining.com
Untitled Document

Recently Updated Websites

Legalmedica.com (9 seconds ago.)Mobiusco.ru (10 seconds ago.)Imperialrealtyco.com (15 seconds ago.)Motie.com (15 seconds ago.)Photographybytatianabotton.com (16 seconds ago.)Lexit.net (17 seconds ago.)Ynzq588.com (19 seconds ago.)Fpispysource.com (21 seconds ago.)Bairrorealty.com (21 seconds ago.)Mystical-science.com (22 seconds ago.)Hao6666.net (28 seconds ago.)Resaltatubelleza.com (29 seconds ago.)Techsellgroup.fr (30 seconds ago.)Byebyebelly.net (32 seconds ago.)Lucitelux.com (35 seconds ago.)Nebula-exhibits.com (36 seconds ago.)247nolice.com (37 seconds ago.)Franchisehealthcare.com (38 seconds ago.)Cherrycapitalservices.com (41 seconds ago.)Quantumqueendom.com (43 seconds ago.)Tab38.net (44 seconds ago.)Akojournal.org.nz (44 seconds ago.)Saltydawgblog.com (45 seconds ago.)Theherbalenchantery.com (49 seconds ago.)Grangepp.com (50 seconds ago.)Viennabestdentist.com (53 seconds ago.)Schaumburg-buch.de (1 minute 1 second ago.)Fancloset.com (1 minute 1 second ago.)Xcsq8.com (1 minute 3 seconds ago.)Kitnadetihai.in (1 minute 4 seconds ago.)

Recently Searched Keywords

internet movie database (1 second ago.)baol (1 second ago.)avez slectionne (2 seconds ago.)padding-bottom 122 media (3 seconds ago.)marwadi gane (4 seconds ago.)residential communities (4 seconds ago.)hotel reservations (4 seconds ago.)все товары в разделе «обложки для документов» (6 seconds ago.)dropdown2597295199dropdownbase (6 seconds ago.)izenz (7 seconds ago.)c21 (7 seconds ago.)osteoporosis (8 seconds ago.)ne pourra tre (9 seconds ago.)godne (9 seconds ago.)recae en t (10 seconds ago.)troll-face-quest-video-games-2 (12 seconds ago.)love to take (12 seconds ago.)exhaust (13 seconds ago.)advanced online (15 seconds ago.)fade away (15 seconds ago.)berat menghadapi (17 seconds ago.)feestdag (17 seconds ago.)65 65 importantcomp-j9zl8qi9 (18 seconds ago.)cnrl horizon camp (19 seconds ago.)claretta (19 seconds ago.)best free porn forums (20 seconds ago.)wed jul (20 seconds ago.)patchwork parking lot (20 seconds ago.)все товары в разделе «обложки для документов» (20 seconds ago.)getstarbeauty (22 seconds ago.)