Beth Israel Deaconess Medical Center | BIDMC of Boston

Safety: Low trust score
Year Founded: 2002
Global Traffic Rank: 30,080
Estimated Worth: $514,800
Category: Health

Beth Israel Deaconess Medical Center (BIDMC), a part of the Beth Israel Lahey Health system, is a world-class teaching hospital of Harvard Medical School.



Domain summary

Last updated
2021-04-12
Domain label
bidmc
Domain extension
org
Domain registered:
2002-05-28
Domain updated:
2021-04-12
Global Traffic Rank
30,080
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$514,800
Estimated daily income
$715
Estimated monthly income
$21,748

Frequently Asked Questions (FAQ)

Q: When was Bidmc.org registered?
A: Bidmc.org was registered 19 years, 7 months, 4 weeks, 2 days, 18 hours, 31 minutes, 23 seconds ago on Tuesday, May 28, 2002.
Q: When was the WHOIS for Bidmc.org last updated?
A: The WHOIS entry was last updated 9 months, 2 weeks, 1 day, 18 hours, 31 minutes, 23 seconds ago on Monday, April 12, 2021.
Q: What are Bidmc.org's nameservers?
A: DNS for Bidmc.org is provided by the following nameservers:
  • ns1.caregroup.org
  • ns2.caregroup.org
Q: Who is the registrar for the Bidmc.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Bidmc.org?
A: Bidmc.org ranks 30,080 globally on Alexa. Bidmc.org has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Bidmc.org each day?
A: Bidmc.org receives approximately 59,619 visitors and 357,714 page impressions per day.
Q: What IP address does Bidmc.org resolve to?
A: Bidmc.org resolves to the IPv4 address 134.174.104.188.
Q: In what country are Bidmc.org servers located in?
A: Bidmc.org has servers located in the United States.
Q: What webserver software does Bidmc.org use?
A: Bidmc.org is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Bidmc.org?
A: Bidmc.org is hosted by Longwood Medical and Academic Area (LMA) in Massachusetts, Boston, United States, 02215.
Q: How much is Bidmc.org worth?
A: Bidmc.org has an estimated worth of $514,800. An average daily income of approximately $715, which is roughly $21,748 per month.

Bidmc.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Bidmc.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Bidmc.org

H1 Headings

1 :
  1. We Put Patients First

H2 Headings

3 :
  1. What's New at BIDMC
  2. Trending Now
  3. Stay Connected

H3 Headings

5 :
  1. COVID-19 and Pregnancy
  2. COVID-19 Pandemic Highlights the Urgent Global Need to Control Air Pollution
  3. With masks on, three feet is just as safe as six feet apart in Massachusetts schools, researchers find
  4. BIDMC Researchers Model a Safe New Normal
  5. Mask-related Acne Tips from a Dermatologist

H4 Headings

5 :
  1. FDA Grants Emergency Use Authorization for COVID-19 Vaccine Developed in Part at BIDMC
  2. BIDMC Recognized as LGBTQ Healthcare Equality Leader
  3. What is BILH Safe Care?
  4. Comprehensive Gender-Affirming Care
  5. Now Offering Telehealth Consults

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

15 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

246:

Links - Internal (nofollow)

0:

Links - Outbound

25:

Links - Outbound (nofollow)

0:

Keyword Cloud for Bidmc.org

healthcareyouisrael deaconesscallgenderaffirmingcovid19emergencydisordersoncologyurgentisraelbeth israel deaconesswetumor programdeaconessconnect with bidmcreadusebraincritical careconditions ampspecialtysearchweightpatient ampusclosepatientallampbeth israelcenters ampvisitor informationtumorbidmchospitalpatientsiteconnectmedicinetherapypainconditionscancerlossmedicalsafeserviceskidneyinformationmoreliverdiseasepatientspatient amp visitorhealthcarecancer programdiseasesinstituteamp visitor informationicuclinicsurgerycentersmorenbsptreatmentsfindcenteryouramp visitorprogramurgent careweight lossusernewvisitorourcriticalbethany

Who hosts Bidmc.org?

Bidmc.org Hosting Provider Information

Hosted IP Address:134.174.104.188
Hosted Hostname:www.bidmc.org
Service Provider:Longwood Medical and Academic Area (LMA)
Hosted Country:United StatesUS
Location Latitude:42.3464
Location Longitude:-71.0975
Webserver Software:Microsoft-IIS/8.5

Is "Longwood Medical and Academic Area (LMA)" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
Longwood Medical and Academic Area (LMA)
0.0006%

HTTP Header Analysis for Bidmc.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 12 Apr 2021 13:46:54 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 24183
Connection: keep-alive
Cache-Control: no-cache, no-store
Pragma: no-cache
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
Access-Control-Allow-Origin: http://bidmc.docksal
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Referrer-Policy: no-referrer-when-downgrade
Content-Security-Policy: default-src https: data: 'unsafe-inline' 'unsafe-eval'
Strict-Transport-Security: max-age=31536000; includeSubDomains

Bidmc.org Domain Nameserver Information

HostIP AddressCountry
ns1.caregroup.org 134.174.104.11United States United States
ns2.caregroup.org 134.174.104.12United States United States


Need to find out who hosts Bidmc.org?


Domain Registration (WhoIs) information for Bidmc.org

 Domain Name: BIDMC.ORG
Registry Domain ID: D87018554-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-02-28T18:59:23Z
Creation Date: 2002-05-28T16:07:05Z
Registry Expiry Date: 2029-05-28T16:07:05Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: Beth Israel Deaconess Medical Center
Registrant State/Province: MA
Registrant Country: US
Name Server: NS1.CAREGROUP.ORG
Name Server: NS2.CAREGROUP.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-11-04T11:16:31Z

Recently Updated Websites

Gzyrsj.com (3 seconds ago.)Sooner.net (4 seconds ago.)Hompimpo.com (5 seconds ago.)Amazontop10deals.com (5 seconds ago.)Mitcalc.com (7 seconds ago.)Otelsa.com (8 seconds ago.)Canasset.com (8 seconds ago.)Kiokunototyu123.tumblr.com (8 seconds ago.)Doradistria.info (9 seconds ago.)Jpcreecy.com (10 seconds ago.)Chuxingvr.com (10 seconds ago.)Friendshipteam.com (11 seconds ago.)Careersourcegc.com (11 seconds ago.)Hyland.design (13 seconds ago.)Tasksdonenow.com (13 seconds ago.)Silentseva.com (14 seconds ago.)Patterncloud.com (15 seconds ago.)Permianworkforcehousing.net (16 seconds ago.)Scopeinc.online (16 seconds ago.)Pennsylvaniadirecthomebuyers.com (17 seconds ago.)365764365.com (17 seconds ago.)Feedprograms.com (17 seconds ago.)Emiray.tv (19 seconds ago.)Brittneygarcia.com (19 seconds ago.)Jjservicecleaning.com (20 seconds ago.)Foto-pavlovic.com (20 seconds ago.)Hwlmgmt.com (21 seconds ago.)Theheartofproduction.org (21 seconds ago.)Crawfordwritingblog.com (21 seconds ago.)Lastlink.xyz (23 seconds ago.)

Recently Searched Keywords

aspettando expo 2020 italia. la bellezza unisce le persone. (1 second ago.)midnight-cat (1 second ago.)2 cách bảo quản tôm khô chuẩn – chỉ dân trong nghề mới biếttôm khô là một nguyên liệu khá phổ biến, chế biến được rất nhiều món ăn ngon ... (1 second ago.)columnas y refrigerantes (2 seconds ago.)kalki termotransferowe (2 seconds ago.)templates css (2 seconds ago.)covid-19 yang (3 seconds ago.)developer relations (4 seconds ago.)thu01b0u1edfng thu1ee9c (5 seconds ago.)mcgraffsamericangrill (6 seconds ago.)dinbsplatina frosinone enbsproma (6 seconds ago.)atıştırmalıklar (6 seconds ago.)januari (1) (6 seconds ago.)rahmetine (7 seconds ago.)alex thorn (8 seconds ago.)manzana asada al horno: receta nutritiva ideal para niã±os (8 seconds ago.)200c (9 seconds ago.)邪恶二次元情头污 (9 seconds ago.)why should a business invest in seo (10 seconds ago.)margin-bottom 3rem (10 seconds ago.)visualheightheightheight visualheightclosestopcssheight heightpx (11 seconds ago.)(see interfaces and translators - eda framework interfaces supported by other vendors) (11 seconds ago.)0left-1pxgrid-area1 (11 seconds ago.)--lnw2px--brd474646--alpha-brd1transform-origincenter 1px (12 seconds ago.)pronto (15 seconds ago.)nft games (16 seconds ago.)yetgin8217den 8 (16 seconds ago.)nova scotia duck tolling retri (16 seconds ago.)spices (masalas)0 items (17 seconds ago.)color 333333 text-align (19 seconds ago.)