Favicon Website Thumbnail
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
Domain extension
Global Traffic Rank
Statvoo Rating
Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income

Rank summary

How is ranked relative to other sites:

Percentage of visits to from a search engine:

Frequently Asked Questions (FAQ)

Q: When was registered?
A: was registered 1 week, 5 days, 16 hours, 41 minutes, 51 seconds ago on Wednesday, September 16, 2020.
Q: When was the WHOIS for last updated?
A: The WHOIS entry was last updated 1 week, 5 days, 16 hours, 41 minutes, 51 seconds ago on Wednesday, September 16, 2020.
Q: What are's nameservers?
A: DNS for is provided by the following nameservers:
Q: Who is the registrar for the domain?
A: The domain has been registered at .
Q: What is the traffic rank for
A: has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit each day?
A: receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does resolve to?
A: resolves to the IPv4 address
Q: In what country are servers located in?
A: has servers located in the Turkey.
Q: What webserver software does use?
A: is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts
A: is hosted by Netinternet Bilgisayar ve Telekomunikasyon San. ve Tic. Ltd. Sti. in Turkey.
Q: How much is worth?
A: has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hosting Provider Information

Hosted IP Address:
Service Provider:Netinternet Bilgisayar ve Telekomunikasyon San. ve Tic. Ltd. Sti.
Hosted Country:TurkeyTR
Location Latitude:41.0214
Location Longitude:28.9948
Webserver Software:Microsoft-IIS/8.5

Is "Netinternet Bilgisayar ve Telekomunikasyon San. ve Tic. Ltd. Sti." in the Top 10 Hosting Companies?


HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=iso-8859-9
Server: Microsoft-IIS/8.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Wed, 16 Sep 2020 05:36:19 GMT
Content-Length: 155433 Domain Nameserver Information

HostIP AddressCountry

Need to find out who hosts

WhoIs information for Free SEO Report

Website Inpage Analysis for

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

4 :

H4 Headings

4 :
  1. Mesafeli Satış Sözleşmesi
  2. Satış ve İptal / İade Koşulları
  3. Üyelik Sözleşmesi
  4. Güvenlik Gizlilik

H5 Headings

0 :

H6 Headings

0 :


0 :

Total Images

20 :

Google Adsense

Not Applicable

Google Analytics

Not Applicable

Links - Internal

  1. No text
  2. No text
  3. Sepetim
  12. BiigBangg
  13. Lego
  14. Matador
  15. Bitz
  16. K'nex
  17. Gen42
  18. Great Minds
  22. No text
  23. ELEKTROLAB MİDİ Model Kodu: 698
  24. No text
  25. ELEKTROLAB Model Kodu: 198
  26. Mesafeli Satış Sözleşmesi
  27. Satış ve İptal / İade Koşulları
  28. Üyelik Sözleşmesi
  29. Güvenlik Gizlilik
  30. İletişim
  31. Sipariş Takip
  32. Üye Ol
  33. Giriş

Links - Internal (nofollow)


Links - Outbound


Links - Outbound (nofollow)


Keyword Cloud for

benzeripazarlamaifastuumlrkbir ekildeveya salaycaldnzsaylbilimciler oyuncakcayma hakknkredi kartbalarortamdabirliktenbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp celektronik postaolmasve eitimtelefonediminindurumundatuumlketiciye anndanbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp 2zarartarihlieitim gereccedilleriilemeye balarulattedarikccediliborccedilipgayrikanunuuumlyelikyazlmyoumlnetmelikfaaliyetlerituumlzelsatveya hizmetintaraflkaytetmekcayma hakkluumltfenitibaren ilemeyewwwbilimcilercomtr 39ninsatc veya salaycsalaycnndacirchil olmakolarakiccedilindepeinen39ninyazl1 bu youmlnetmeliksoumlzlemelerdedamaccedillarlateslimolarak veyauumlruumlnuuml7 guumln iccedilerisindeilgili nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp2soumlzlemenineitim gereccedilleri a39ninuumlyetaahhuumltbeyanhakknabilgileriyazl olarak veyahatassatcsahiptirsoumlzlememinusiadenizsatc veya salaycnnamactuumlketicinin malsoumlzyeresmisoumlzlemelerwwwbilimcilercomtr tarafndaniccedilerisindeelektronik posta adresinioumldemeiadeaykrinciolmayaniccedilinherhangi bir ekildeiptalkurallar veguumln iccedilerisindeherbalcaymasoumlzlemede belirtilensoumlzleme konusu mal0yaplanmeslekiposta adresiniuumlye39yefkradasitesinicayma hakk suumlresibankasalaycyuumlkuumlmluumlluumluumluumlruumln vesoumlzlemeler nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspsoumlzleme konusuyuumlruumlrluumleyoumlneliknbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp bbir malilikin soumlzlemeler nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspetmiyertarihikodukamubir mal veyaticaretaadakiguumlnluumlkdairbir suumlrekli7 guumlnuuml aanettiinizdeiiklikilgili olarakwwwbilimcilercomtritibarenmal veya hizmetinbu soumlzlemeguumlnuuml aanilgiliuumlyeliigerekirtaycsylaistediinizveriadresinihizmetinhukukiolduuederaittirsoumlzlemeleretuumlmolupitibaren ilemeye balarteslimineinternetancaktuumlrluumlifave kiiselsoumlzlemedebir suumlrekli veriuumlyeyeticari veya meslekinbspve elektronik ortamdabizemaddesanayi vebilgileriniziboumlluumlmnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp 3oumlnhizmetkaryaiadesi kabulveyaanndaquotuumlruumlnkartkullancnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp dsakldrkullanclarnkartalephakkndahakknnolduunuzbaka birbirinci fkradaaldguumlndengeccedilerlisuumlrekli veri taycsylagoumlndermenizuzaktan iletiimileveveyasonrauumlccedildierkullanlan1 buve elektronikpostanbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp ccedilgeccedilyazl olarakkullanlmamncdauumlruumlnuumlnyasalyetkilielektrkticarikullanma4kargo irketibedelikar karyaher tuumlrluumlgenelbilgilendirmeteslimine ilikinaynenbilimcilertekhizmetleruygunmalia39ninuumlruumlnlegeribirincicayma hakknnveya bir suumlrekliyaamac ileibu soumlzlemedeguumln iccedilindemodel kodukiiselve eitim gereccedillerikarya gelinmeksizingoumlstermeksizinkonusumalnaanilemeyeguumlnden itibaren ilemeyesuumlrekli verioyuncak veedilenkapsamhalindeeitimaynkullanmdanhakkiilerinambalajnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp fiade etmekincelemegelinmeksizindoabilecekhiccedilbiruumlruumlnlerinbukorunmasguumlnuumltl elektrolabelektronik ortamdadahahizmetikargo uumlcretidacirchil olmak uumlzereveya biryuumlkuumlmluumlduumlrandan itibarendolaysuumlreccediliadesigereccedilleri a39ninayrcaemailuumlruumlnuuml teslimkullanlmasgerccedilekalmmesafelitakdirdefiyatbilgileringuumlnden itibarenteslimioumlnceiletiimtuumlzel kiileriminus 1 busuumlresioyuncak ve eitimsitesindeuumlyenintek taraflhakknminus 17 guumlngibiticari veyaverenherhangi birsuumlratziyaretekildegereccedilleri6 ncbelirtileniccedilerensuumlrat kargoaksiilikinveya meslekigizlilikyer alandacirchilolansonaedilmesihacirclindeuumlccediluumlncuuml kiimaddigoumlrselibubilgi5bilimciler oyuncak veandanolmak uumlzerenbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp maddeve ticaretherhangi7 guumlnuumlmalmal veyakartlarveri taycsylackargobilgilerisekabul etmidemografikbulunamazkiilerigayri madditlbu suumlrezamantarihli veile ilgilikonusu malf6alannbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp edndanbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspkabul ederiadeninbu youmlnetmelikuumlzerindenilemikabulnedeniyleoyuncaksuumlretuumlketiciyekar karya gelinmeksizinelektrolabkullanmtakipadernleruumlruumlnlermesafeli soumlzlemelerdesoumlzlemelerde tuumlketicininve benzeriedenfarklsanayimodelbilgilerinizinsalamakirketibuumltuumln1sizeuumlzereaitesanayi ve ticaretdurumlardatuumlketicisoumlz konusuvbgerekmektedirhacircllerde3kredihalde5 incikurallarveya salaycnnkendisinehakkteslim aldbakasonguumlntarafndantuumlketicininolmaktazminatsiteningereklive kredikiinbspnbspyenilenmiaccedilkgirioumlzelyineuumlcretiszlemesisiteuzaktancezaiartlarnuumlruumlnsiparihizmetlerinhakk suumlresikullanm artlarnhakkna sahiptirhelektronikazalmasamacylailikin soumlzlemelerartlarccedilvarsabildirimsuumlreklisatnborijinalya davesitedekoullarsatc veyabirolarak veya biruumlccediluumlncuumlyerine

Longtail Keyword Density for

satc veya salayc9
ve eitim gereccedilleri7
oyuncak ve eitim7
bilimciler oyuncak ve7
minus 1 bu6
ilikin soumlzlemeler nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp6
7 guumln iccedilerisinde4
cayma hakk suumlresi4
bir suumlrekli veri4
1 bu youmlnetmelik4
olarak veya bir4
veya bir suumlrekli4
yazl olarak veya4
mal veya hizmetin4
herhangi bir ekilde3
eitim gereccedilleri a39nin3
7 guumlnuuml aan3
ve elektronik ortamda3
kar karya gelinmeksizin3
sanayi ve ticaret3
ticari veya mesleki3
dacirchil olmak uumlzere3
itibaren ilemeye balar3
guumlnden itibaren ilemeye3
bir mal veya3
suumlrekli veri taycsyla3
satc veya salaycnn3
soumlzleme konusu mal3
elektronik posta adresini3
her tuumlrluuml18
herhangi bir15
minus 115
satc veya13
ya da13
ile ilgili11
bir ekilde10
mal veya9
veya salayc9
yer alan9
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp madde8
guumln iccedilerisinde8
oyuncak ve7
ve eitim7
eitim gereccedilleri7
yazl olarak7
elektronik ortamda7
veya hizmetin7
bilimciler oyuncak7
guumlnden itibaren6
ilikin soumlzlemeler6
soumlzlemeler nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp6
uzaktan iletiim6
elektronik posta6
kredi kart6
1 bu6
andan itibaren6
7 guumln5
suumlrekli veri5
soumlz konusu5
cayma hakknn5
cayma hakk5
bu youmlnetmelik5
kabul eder5
soumlzleme konusu5
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp 25
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp b5
olmak uumlzere5
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp c5
ibu soumlzlemede4
bu suumlre4
wwwbilimcilercomtr tarafndan4
kabul etmi4
bu soumlzleme4
hakk suumlresi4
teslimine ilikin4
bir suumlrekli4
cayma hakkn4
olarak veya4
suumlrat kargo4
model kodu4
veya bir4
birinci fkrada4
tuumlzel kiileri4
5 inci4
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp d4
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp ccedil4
tuumlketicinin mal4
konusu mal4
ilgili olarak3
iadesi kabul3
tek tarafl3
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp 33
7 guumlnuuml3
guumlnuuml aan3
gereccedilleri a39nin3
kargo irketi3
kargo uumlcreti3
ve elektronik3
ve kiisel3
karya gelinmeksizin3
kullanm artlarn3
kurallar ve3
6 nc3
wwwbilimcilercomtr 39nin3
kar karya3
amac ile3
ilgili nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp3
soumlzlemede belirtilen3
tuumlketiciye annda3
posta adresini3
sanayi ve3
tarihli ve3
teslim ald3
tl elektrolab3
veya salaycnn3
mesafeli soumlzlemelerde3
bir mal3
veya mesleki3
hakkna sahiptir3
ticari veya3
veri taycsyla3
dacirchil olmak3
soumlzlemelerde tuumlketicinin3
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp f3
uumlruumlnuuml teslim3
itibaren ilemeye3
ilemeye balar3
nbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbspnbsp e3
gayri maddi3
ve benzeri3
uumlccediluumlncuuml kii3
iade etmek3
guumln iccedilinde3
baka bir3
ve ticaret3
ve kredi3
uumlruumln ve3
e-mail3 Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?

Websites with Similar Names
Bilim - All / Негізгі бет
Bilim - Teknoloji - IHS Park Page
سایت نرم افزار بیلیم لایف - Türkiye'nin Bilim Sitesi | | Ücretsiz yap?m a?amas?nda sayfas?
Bilim Ad?mlar? | Toplumda bilimi yayg?nla?t?rmak için olu?turulmu? bir projedir.

Recently Updated Websites 5 seconds 6 seconds 6 seconds 6 seconds 6 seconds 6 seconds 6 seconds 7 seconds 8 seconds 8 seconds 8 seconds 9 seconds 9 seconds 9 seconds 9 seconds 9 seconds 9 seconds 9 seconds 10 seconds 10 seconds 11 seconds 12 seconds 12 seconds 12 seconds 14 seconds 15 seconds 15 seconds 15 seconds 16 seconds 16 seconds ago.