| - din leverandør af billige tryksager i høj kvalitet!
Low trust score  | 
Velkommen hos Vi er din leverandør af billige tryksager. Klik her og se vores store udvalg! Website Information has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 672,809, a Majestic Rank of 0, a Domain Authority of 37% and is not listed in DMOZ. is hosted by Bredbaand Nord A/S in Nordjylland, Bronderslev, Denmark, 9700. has an IP Address of and a hostname of

The domain was registered 201 decades 8 years 9 months ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.

Whois information for

Full Whois Lookup for Whois Lookup

# Hello 2a01:7e00::f03c:91ff:fe84:f734. Your session has been logged.
# Copyright (c) 2002 - 2017 by DK Hostmaster A/S
# Version: 2.0.2
# The data in the DK Whois database is provided by DK Hostmaster A/S
# for information purposes only, and to assist persons in obtaining
# information about or related to a domain name registration record.
# We do not guarantee its accuracy. We will reserve the right to remove
# access for entities abusing the data, without notice.
# Any use of this material to target advertising or similar activities
# are explicitly forbidden and will be prosecuted. DK Hostmaster A/S
# requests to be notified of any such activities or suspicions thereof.

Registered: 2006-01-10
Expires: 2018-01-31
Registration period: 1 year
VID: no
Dnssec: Unsigned delegation
Status: Active


# Use option --show-handles to get handle information.
# Whois HELP for more help.

Who hosts Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Bredbaand Nord A/S
Hosted Country:DenmarkDK
Location Latitude:57.2702
Location Longitude:9.94102
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 14 Sep 2015 01:08:19 GMT
Server: Apache/2.4.7 (Ubuntu) PHP/5.5.9-1ubuntu4.5 OpenSSL/1.0.1f
X-Powered-By: PHP/5.5.9-1ubuntu4.5
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Tiger: Dont you know its rude to look at other peoples naked headers?
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 9695
Content-Type: text/html; charset=utf-8
Strict-Transport-Security: max-age=3600

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

hosgroggpguidenyhedsbrevpostkortsalgsmapperfarverrygbreddesomthisparentsuntilfoldereerundervisning i grafiskflyersgrafiskmedkravspecifikationereksemplarostrykkeriganyhedergrafisk produktionmerextilprovaromthisparentsuntil divsubmenuheledenproduktionet eksemplar afbrugerbrevpapirpet eksemplardivsubmenuvisitkortklistermrkernemtdutryksagerhar duetvidu ervrktjkandigdu kanogsundervisningcase1 kravspecifikationer farversprgsmldadetom billigtryksagdkhfterfrnr dunrcase1afnbspcase1 kravspecifikationerkuverterellerbilligtryksagdkvoresmegettrykkeriet0kunderbrugvedplakaterkravspecifikationer farverhardermedlemtilbagedinpro brugerkan dueksemplar aflandetgavekorthele landet

Longtail Keyword Density for

et eksemplar af3
case1 kravspecifikationer farver3
undervisning i grafisk3
du kan5
kravspecifikationer farver5
har du5
pro bruger5
du er4
om billigtryksagdk4
nr du3
hele landet3
eksemplar af3
case1 kravspecifikationer3
thisparentsuntil divsubmenu3
kan du3
grafisk produktion3
et eksemplar3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Denmark Belgium Kingdom United Kingdom Republic Czech Republic Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?