|  Online Bingo - Play Online Bingo Games - Free $25 Only at BingoHall
Low trust score  | 
Online bingo games you can play at BingoHall offer real cash prizes and jackpots! $25 FREE with sign up to play over 300 online bingo games Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:H
Alexa Rank Alexa Rank:258,881
Majestic Rank Majestic Rank:919,651
Domain Authority Domain Authority:34%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: Nic AG
Registration Date:2011-05-31  7 years 9 months 2 weeks ago
Last Modified:2015-04-29  3 years 10 months 2 weeks ago
Expiration Date:2017-05-31  1 year 9 months 2 weeks ago
Owner's E-Mail:Login to show email

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: D105800000001972287-AGRS
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-05-29T23:30:30Z
Creation Date: 2011-05-31T08:19:59Z
Registry Expiry Date: 2019-05-31T08:19:59Z
Registrar Registration Expiration Date:
Registrar: SafeNames Ltd.
Registrar IANA ID: 447
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Registry Registrant ID: C16365934-AGRS
Registrant Name: Nixon Ricardo Rivera Blanco
Registrant Organization: Digital Entertainment Services Ltd
Registrant Street: PB 234 Cooks Street
Registrant City: Numbatu
Registrant State/Province:
Registrant Postal Code: 0000
Registrant Country: VU
Registrant Phone: +44.7968770904
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C16396165-AGRS
Admin Name: International Domain Administrator
Admin Organization: Safenames Ltd
Admin Street: PO Box 5085
Admin City: Milton Keynes MLO
Admin State/Province:
Admin Postal Code: MK6 3ZE
Admin Country: GB
Admin Phone: +44.1908200022
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C16391253-AGRS
Tech Name: International Domain Tech
Tech Organization: International Domain Tech
Tech Street: PO Box 5085
Tech City: Milton Keynes MLO
Tech State/Province:
Tech Postal Code: MK6 3ZE
Tech Country: GB
Tech Phone: +44.1908200022
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS1.P40.DYNECT.NET
Name Server: NS2.P40.DYNECT.NET
Name Server: NS3.P40.DYNECT.NET
Name Server: NS4.P40.DYNECT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-16T19:24:51Z

Who hosts is hosted by Solar Communications GMBH in Switzerland. has an IP Address of and a hostname of and runs nginx/1.0.15 web server. Web Server Information

Hosted IP Address:
Service Provider:Solar Communications GMBH
Hosted Country:SwitzerlandCH
Location Latitude:47
Location Longitude:8
Webserver Software:nginx/1.0.15

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.0.15
Date: Tue, 30 Jun 2015 22:32:16 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Powered-By: PHP/5.4.42
Expires: Sat, 01 Jan 2000 00:00:01 GMT
Cache-Control: post-check=0, pre-check=0, max-age=0
Last-Modified: Tue, 30 Jun 2015 22:32:16 GMT
Pragma: no-cache
Content-Encoding: gzip
X-Iinfo: 4-35176687-35176688 NNNN CT(22 23 0) RT(1435703854107 14) q(0 0 0 -1) r(2 2)
X-CDN: Incapsula

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

website3messagewinnerslogin freerateliketheylogin ampcommunityherelogin free signupweamp play practicepracticejoinyourdochatjackpot 0seeplayers onlinebingohallhelpgamingall0 loginamp play cardampfree signup login1varamp playoctoberplay card costplayers online rategamesautocancelprizegreat6passwordcardweeklyusjustplacecontactresetemailclickgasetplayfav closehavecard costplay cardclose login ampfree2youcodefavcloseplayersverification codefav close loginfunjackpotsmsonlinegamecostaliasthankfunctionloginonline ratetrycoolnewplay practice0 login ampverificationdollareachsignupgaxyzsetgame favgame fav closenownbsp joinroomsrate it favbeenthank youifoverallnbspfree signupmoreclose loginsignup loginsignup login freewonsafe405login amp playbingosent

Longtail Keyword Density for

login amp play18
close login amp12
players online rate12
fav close login12
amp play practice10
game fav close7
play card cost6
amp play card6
0 login amp6
login free sign-up5
rate it fav4
sign-up login free3
free sign-up login3
amp play18
login amp18
close login12
online rate12
fav close12
players online12
play practice10
game fav7
card cost6
play card6
free sign-up6
0 login6
login free5
jackpot 04
thank you3
sign-up login3
nbsp join3
verification code3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?