Birdtrader.co.uk  |  Birds for sale | Birdtrader
Low trust score  | 
Birdtrader, the UK's no.1 marketplace for buying and selling birds.

Birdtrader.co.uk Website Information

Birdtrader.co.uk has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 348,763, a Majestic Rank of 915,316, a Domain Authority of 41% and is listed in DMOZ.

Birdtrader.co.uk is hosted by ClaraNET LTD in Portugal.
Birdtrader.co.uk has an IP Address of 195.22.8.228 and a hostname of lotus.memoriavisual.net and runs nginx/1.4.1 web server.

The domain birdtrader.co.uk was registered 1 decade 2 years 11 months ago by , it was last modified 4 years 6 months 3 days ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for birdtrader.co.uk

Full Whois Lookup for Birdtrader.co.uk Whois Lookup

Domain name:
birdtrader.co.uk

Registrant:
Friday-Ad Ltd

Registrant type:
UK Limited Company, (Company number: 2311783)

Registrant's address:
Friday Ad Ltd
London Road
Sayers Common
BN6 9HS
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 15-Jan-2015

Registrar:
Friday-Ad Ltd t/a Friday Media Group Ltd [Tag = FRIDAY-AD]
URL: http://www.friday-ad.co.uk

Relevant dates:
Registered on: 10-Aug-2006
Expiry date: 10-Aug-2018
Last updated: 18-Jul-2016

Registration status:
Registered until expiry date.

Name servers:
carl.ns.cloudflare.com
lucy.ns.cloudflare.com

WHOIS lookup made at 02:50:30 13-Sep-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Birdtrader.co.uk?

Birdtrader.co.uk Web Server Information

Hosted IP Address:195.22.8.228
Hosted Hostname:lotus.memoriavisual.net
Service Provider:ClaraNET LTD
Hosted Country:PortugalPT
Location Latitude:38.7139
Location Longitude:-9.1394
Webserver Software:nginx/1.4.1

HTTP Header Analysis for Birdtrader.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.4.1
Date: Thu, 28 May 2015 08:53:13 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Powered-By: PleskLin
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip


Need to find out who hosts Birdtrader.co.uk?

Birdtrader.co.uk Free SEO Report

Website Inpage Analysis for Birdtrader.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Birdtrader.co.uk

galahgreencamplinplester tipplertalkingsalepoundmidlandsnbsp westgalah cockatoossearch allhours highbirdtradercoukdocumentreadyfunctionpigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmike camplinplesterpigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmike camplinplester tipplerwestpoundfreetalking parrot poundparrots for salevarnorth eastpoundother birdsyorkshirenbsp north east2hours agohandrearedviewbaby galah cockatoosyouconurehours agohand rearedbirds otherverysale 4cockatoos for salepigeonsallagohand rearedbirdsavonnbsp south westpoundsouth westpound15midlandspoundadreared babyouragohandgreysbirds search allagohand reared babysearchpheasantswest3 hoursbaby greenflyingparrot poundwest3salecamplinplestertippler pigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmike camplinplesteryoursea birdsnorth west3 hoursgoldgeesewest midlandspound2midlandsnbsphandparrothigh flyingsale 153allsalehumbersidenbspnorth east2 hoursbirdsavonnbsp southqualitybirds searchmanchesternbsp north west3parrotssalehumbersidenbsp northcockatoosringnecknorth east2salewest4undefinedsalehumbersidenbsp north eastpoundmanchesternbsp northmanchesternbspnorthsale 2rearedafricantippler pigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmikechickenadminmodecategorytrueeast2 hoursbabysalebirdmidlandsnbsp west midlandspound0mesalewildbirdspoultryflying tippler pigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmikepigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmikewadingtalking parrotteal for salepoundbirds other birds1sale 3all6sale 6teal for salehumbersidenbspbirdtradertamehightealbaby galahsale 1yorkshirenbspducksswansfeedbirds viewhigh flying tippler1 othereast2tame babyothersaleothereast2 hours agohandbirdaccessoriestipplermilesquakerwading birdssouthfeedgamepoundbirds by categoryeastpoundbirdsavonnbspnorth west3westhourshours agohandagohandrearedhours high flyingyorkshirenbsp northflying tipplerseafalse

Longtail Keyword Density for Birdtrader.co.uk

KeywordsOccurences
salehumbersidenbsp north eastpound8
midlandsnbsp west midlandspound7
agohand reared baby6
talking parrot pound6
hours agohand reared6
yorkshirenbsp north east25
east2 hours agohand5
north east2 hours5
parrots for sale4
teal for salehumbersidenbsp3
teal for salepound3
north west3 hours3
manchesternbsp north west33
flying tippler pigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmike3
baby galah cockatoos3
birds search all3
birds by category-3
cockatoos for sale3
birdsavonnbsp south westpound3
hours high flying3
tippler pigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmike camplinplester3
birds other birds3
high flying tippler3
pigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmike camplinplester tippler3
north eastpound13
reared baby10
yorkshirenbsp north9
sale 1-8
salehumbersidenbsp north8
midlandsnbsp west8
west midlandspound7
hours agohand7
other birds7
south westpound7
agohand reared6
tame baby6
parrot pound6
talking parrot6
manchesternbsp north5
sale 2-5
north east25
east2 hours5
sea birds4
west3 hours3
camplinplester tippler3
pigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmike camplinplester3
birds other3
baby green3
tippler pigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmike3
hours agohand-reared3
north west33
high flying3
baby galah3
galah cockatoos3
sale 6-3
birds view3
birds search3
search all3
sale 15-3
sale 4-3
hours high3
wading birds3
sale 3all3
birdsavonnbsp south3
1- other3
flying tippler3
sale61
north35
birds29
baby17
other16
all15
hours15
eastpound14
reared13
bird13
south11
category-11
1-10
west10
westpound9
parrots9
yorkshirenbsp9
accessories9
talking8
salehumbersidenbsp8
var8
salepound8
midlandsnbsp8
midlandspound7
parrot7
quality7
agohand7
miles7
pound7
2-7
ducks6
teal6
saleother6
geese6
tame6
tippler6
salewild5
conure5
poultry5
east25
documentreadyfunction5
manchesternbsp5
african4
me4
04
high4
free4
sea4
hand4
cockatoos4
birdtrader4
feed4
6-4
3all4
west33
camplinplester3
very3
adminmode3
true3
green3
agohand-reared3
gold3
birdtradercouk3
undefined3
ringneck3
search3
pheasants3
4-3
pigeons3
chicken3
15-3
greys3
our3
false3
your3
feedgame3
wading3
quaker3
galah3
salewest3
birdsavonnbsp3
flying3
view3
you3
ad3
swans3
salebird3
pigeonsbowdenshanonpilotsanslowsheffieldhugheslovettsmacclesfieldmike3

What are the nameservers for birdtrader.co.uk?

Birdtrader.co.uk Domain Nameserver Information

HostIP AddressCountry
ns.rackspace.com 69.20.95.4United States United States
ns2.rackspace.com 65.61.188.4United States United States

Birdtrader.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Birdtrader.co.uk is a scam?