
Lkw Fahrer gesucht - Kraftfahrer Stellenangebote & Lkw Fahrer Jobs
Low trust score
Add a review Change category Claim this site
Lkw Fahrer gesucht - Berufskraftfahrer Jobs | Truckerbörse - Jobbörse | Berufskraftfahrer Stellenangebote | Kraftfahrer + Trucker Jobs Fernfahrer gesucht

Domain summary

Domain label
Domain extension
Global Traffic Rank
Statvoo Rating
Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income

Rank summary

How is bkf-stellenmarkt.de ranked relative to other sites:

Percentage of visits to bkf-stellenmarkt.de from a search engine:

Frequently Asked Questions (FAQ)

Q: When was Bkf-stellenmarkt.de registered?
A: Bkf-stellenmarkt.de was registered 1 week, 1 day, 23 hours, 7 minutes, 17 seconds ago on Tuesday, September 15, 2020.
Q: When was the WHOIS for Bkf-stellenmarkt.de last updated?
A: The WHOIS entry was last updated 1 year, 7 months, 4 weeks, 2 days, 23 hours, 7 minutes, 17 seconds ago on Thursday, January 24, 2019.
Q: What are Bkf-stellenmarkt.de's nameservers?
A: DNS for Bkf-stellenmarkt.de is provided by the following nameservers:
  • ns01.one.com
  • ns02.one.com
  • ns03.one.com
Q: Who is the registrar for the Bkf-stellenmarkt.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Bkf-stellenmarkt.de?
A: Bkf-stellenmarkt.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Bkf-stellenmarkt.de each day?
A: Bkf-stellenmarkt.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Bkf-stellenmarkt.de resolve to?
A: Bkf-stellenmarkt.de resolves to the IPv4 address
Q: In what country are Bkf-stellenmarkt.de servers located in?
A: Bkf-stellenmarkt.de has servers located in the Denmark.
Q: What webserver software does Bkf-stellenmarkt.de use?
A: Bkf-stellenmarkt.de is powered by Apache/2.4.25 webserver.
Q: Who hosts Bkf-stellenmarkt.de?
A: Bkf-stellenmarkt.de is hosted by One.com A/S in Capital Region, Copenhagen, Denmark, 1052.
Q: How much is Bkf-stellenmarkt.de worth?
A: Bkf-stellenmarkt.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Bkf-stellenmarkt.de?

Bkf-stellenmarkt.de Hosting Provider Information

Hosted IP Address:
Hosted Hostname:webcluster8.webpod6-cph3.one.com
Service Provider:One.com A/S
Hosted Country:DenmarkDK
Location Latitude:55.6786
Location Longitude:12.5589
Webserver Software:Apache/2.4.25

Is "One.com A/S" in the Top 10 Hosting Companies?


HTTP Header Analysis for Bkf-stellenmarkt.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 15 Sep 2020 17:24:08 GMT
Server: Apache/2.4.25
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 38544
Content-Type: text/html; charset=UTF-8

Bkf-stellenmarkt.de Domain Nameserver Information

HostIP AddressCountry

Need to find out who hosts Bkf-stellenmarkt.de?

WhoIs information for Bkf-stellenmarkt.de

 % Restricted rights.
% Terms and Conditions of Use
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html

Domain: bkf-stellenmarkt.de
Nserver: ns01.one.com
Nserver: ns02.one.com
Nserver: ns03.one.com
Dnskey: 257 3 13 pOVp7W5Y/qVLifgKR5+m2YiGOzIRpdgTB+TqkzoNszYGHsQkHMh8HT0B17UoDL2n2gCNzR4/NpW9aWV7U4kWqw==
Status: connect
Changed: 2019-01-24T03:13:02+01:00

Bkf-stellenmarkt.de Free SEO Report

Website Inpage Analysis for Bkf-stellenmarkt.de

H1 Headings

1 :
  1. LKW-Fahrer-gesucht.com - Der Kraftfahrer Stellenmarkt für Lkw Fahrer & Trucker Jobs

H2 Headings

151 :
  1. Fernfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  2. LKW-Fahrer (m/w/d) für Werksverkehr
  3. Lkw Fahrer (m/w/d)* | C | für die Auslieferung
  4. Lkw Fahrer (m/w/d)* | CE | Lebensmittel-Transporte
  5. Auslieferungsfahrer/Lkw-Fahrer (m/w/d)* | CE | Textiltransporte
  6. Lkw Fahrer (m/w/d)* | CE | Auslieferung
  7. Lkw Fahrer (m/w/d)* | CE | nat. FV
  8. Berufskraftfahrer (m/w/d)* | CE | Nah- und Fernverkehr
  9. Lkw Fahrer (m/w/d)* | CE | Nah- und Fernverkehr
  10. Lkw Fahrer (m/w/d)* | CE | Volumentransporte
  11. Gefahrgutfahrer (m/w/d)* | CE | ADR Gefahrgut
  12. Lkw Fahrer (m/w/d)* | C1, C, C1E, CE | Baustoffe
  13. Auslieferungsfahrer/Lkw-Fahrer (m/w/d)* | CE | Textiltransporte
  14. Berufskraftfahrer in Vollzeit (m/w/d)* | CE | Tagestouren - Baustoffe
  15. Berufskraftfahrer (m/w/d)* | CE | Auslieferung | Linienverkehr in Tag- und Nachtschicht
  16. Auslieferungsfahrer (m/w/d)* | C | Auslieferung
  17. Lkw Fahrer (m/w/d)* | CE | Getränke
  18. Lkw Fahrer (m/w/d)* | CE | Getränke
  19. Kraftfahrer (m/w/d)* | CE | Koffersattel, Intern. Fernverkehr, 5 Tage Woche
  20. Lkw Fahrer (m/w/d)* | C | Arbeitsbühnen- & Staplervermietung
  21. Kraftfahrer (m/w/d)* | CE | nationaler Fernverkehr
  22. Berufskraftfahrer in Vollzeit (m/w/d)* | CE | Tagestouren - Baustoffe
  23. LKW Fahrer | Kraftfahrer (m/w/d)* | CE | 450€ Basis | Getränke
  24. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  25. Lkw Fahrer (m/w/d)* | CE | Lebensmittel-Transporte
  26. Berufskraftfahrer (m/w/d)* | CE | Schüttgüter
  27. Lkw Fahrer (m/w/d)* | CE | Baustoffe
  28. Kraftfahrer (m/w/d)* | CE | ADR Gefahrgut
  29. Lkw Fahrer (m/w/d)* | CE | Lebensmittel
  30. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr
  31. Lkw Fahrer (m/w/d)* | C | Logistik
  32. Kraftfahrer (m/w/d)* | C und CE | Lebensmitteltransporte
  33. Kraftfahrer (m/w/d)* | C und CE | Lebensmitteltransporte
  34. Berufskraftfahrer (m/w/d)* | CE | Wechselbrücken | Drehschemel | Nah + Fernverkehr | Tag + Nacht
  35. Berufskraftfahrer (m/w/d)* | CE | Wechselbrücken | Drehschemel | Nah + Fernverkehr | Tag + Nacht
  36. Kraftfahrer (m/w/d)* | CE | Nahverkehr
  37. Lkw Fahrer (m/w/d)* | CE | Nahverkehr
  38. Kraftfahrer (m/w/d)* | CE | Nah- und Fernverkehr
  39. Kraftfahrer (m/w/d)* | CE | nat. FV
  40. Berufskraftfahrer (m/w/d)* | C | Logistik
  41. Auslieferungsfahrer (m/w/d)* | C | Fruchtimporte
  42. Berufskraftfahrer (m/w/d)* | C | Nahverkehr
  43. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  44. Lagerist | Kraftfahrer (m/w/d)* | C1E | Belieferung von Baustellen
  45. Berufskraftfahrer (m/w/d)* | CE | Belieferung von Tankstellen mit Kraftstoff im 2-Schichtdienst
  46. Berufskraftfahrer (m/w/d)* | CE | Belieferung von Tankstellen mit Kraftstoff im 2-Schichtdienst
  47. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  48. Lkw Fahrer (m/w/d)* | CE | Nah- und Fernverkehr
  49. Berufskraftfahrer (m/w/d)* | CE | Nah- und Regionalverkehr
  50. Berufskraftfahrer (m/w/d)* | CE | Nah- und Regionalverkehr
  51. Kranwagenfahrer (m/w/d)* | CE | Baustoffe
  52. Kraftfahrer (m/w/d)* für Sattel oder Hängerzug im Nahverkehr
  53. Kraftfahrer (m/w/d)* | CE | Eisen- bzw. Stahltransporte
  54. Kraftfahrer (m/w/d)* | CE | Containertransporte
  55. Kraftfahrer (m/w/d)* | CE | Nahverkehr
  56. Kraftfahrer (m/w/d)* | CE | Lebensmitteltransporte
  57. Kraftfahrer (m/w/d)* | CE | Lebensmitteltransporte
  58. Berufskraftfahrer (m/w/d)* | CE | Kühl- und Frischgut-Transporte
  59. Auslieferungsfahrer (m/w/d)* | CE | Kühl- und Frischgut-Transporte
  60. Kraftfahrer (m/w/d)* CE für Fahrmischer
  61. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  62. Lkw Fahrer (m/w/d)* | CE | Nah- und Fernverkehr
  63. Berufskraftfahrer (m/w/d)* | C1E | Stückgut
  64. Berufskraftfahrer (m/w/d)* | CE | Eisen- bzw. Stahltransporte
  65. Lkw Fahrer (m/w/d)* | CE | Sattel & Hänger
  66. Lkw Fahrer (m/w/d)* | CE | Fernverkehr Deutschland
  67. Berufskraftfahrer (m/w/d)* | CE | ADR Gefahrgut
  68. Auslieferungsfahrer/Lkw-Fahrer (m/w/d)* | CE | Textiltransporte
  69. Auslieferungsfahrer (m/w/d)* | C | Logistik
  70. Lkw Fahrer (m/w/d)* | CE | Nah- und Fernverkehr
  71. Lkw Fahrer (m/w/d)* | CE | Betonwaren
  72. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  73. Kraftfahrer (m/w/d)* | C1E/CE + Eintrag 95
  74. Lkw Fahrer (m/w/d)* | CE | Baustellenverkehr
  75. Tankwagenfahrer (m/w/d)* | CE | ADR Gefahrgut
  76. Kraftfahrer (m/w/d)* | B - C1 - C - CE | Auslieferung | Berlin & Brandenburg
  77. Berufskraftfahrer (m/w/d)* | CE | Autotransporte
  78. Berufskraftfahrer (m/w/d)* | CE | Planensattel
  79. Fernfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  80. Fernfahrer (m/w/d)* | CE | Spezial- bzw. Schwerlasttransporte
  81. Berufskraftfahrer (m/w/d)* | CE | Baustoffe
  82. Auslieferungsfahrer/Lkw-Fahrer (m/w/d)* | CE | Textiltransporte
  83. Kraftfahrer (m/w/d)* | CE | Auslieferung
  84. Berufskraftfahrer (m/w/d)* | CE | Nah- und Fernverkehr
  85. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  86. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  87. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  88. LKW-Fahrer / Monteur Verkehrstechnik (m/w/d)* | CE | Traffic Systeme
  89. Auslieferungsfahrer (m/w/d)* | C | Werks- Nahverkehr Reinickendorf
  90. Lkw Fahrer (m/w/d)* | C | Lebensmitteltransporte
  91. Lkw Fahrer (m/w/d)* | C | Lebensmitteltransporte
  92. Kraftfahrer (m/w/d)* | CE | Kühl- und Frischgut-Transporte
  93. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  94. Lkw Fahrer (m/w/d)* | C | Logistik
  95. Lkw Fahrer (m/w/d)* | CE | Nahverkehr
  96. Lkw Fahrer (m/w/d)* | CE | Abroller | Absetzer | Sattelkipper | Saug- u. Spülwagen | Betonmischer
  97. Lkw Fahrer (m/w/d)* | CE | Baustoffe
  98. Lkw Fahrer (m/w/d)* | CE | Silo
  99. Lkw Fahrer (m/w/d)* | C | Logistik
  100. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  101. Berufskraftfahrer (m/w/d)* | C-CE | Lebensmitteltransporte
  102. Berufskraftfahrer (m/w/d)* | CE | nationaler Fernverkehr
  103. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  104. Lkw Fahrer (m/w/d)* | C | Lebensmitteltransporte
  105. Lkw Fahrer (m/w/d)* | C | Lebensmitteltransporte
  106. Auslieferungsfahrer (m/w/d)* | CE | Nahverkehr
  107. Kraftfahrer (m/w/d)* | CE | Kühl- und Frischgut-Transporte
  108. Kraftfahrer (m/w/d)* | C | Recycling
  109. Kraftfahrer (m/w/d)* | CE | Recycling | Absetzkipper
  110. Lkw Fahrer (m/w/d)* | CE | ADR Gefahrgut
  111. Lkw Fahrer (m/w/d)* | CE | Entsorgung
  112. Lkw Fahrer (m/w/d)* | CE | Lebensmittel
  113. Lkw Fahrer (m/w/d)* | CE | Fernverkehr Deutschland
  114. Berufskraftfahrer (m/w/d)* | C1 | Nahverkehr
  115. Berufskraftfahrer (m/w/d)* | CE | Nahverkehr
  116. Fernfahrer (m/w/d)* | CE | Kühl- und Frischgut-Transporte
  117. Kraftfahrer (m/w/d)* CE für Silozementzug
  118. Berufskraftfahrer in Vollzeit (m/w/d)* | CE | Tagestouren - Baustoffe
  119. Kraftfahrer (m/w/d)* | CE | Logistik
  120. Kraftfahrer (m/w/d)* | CE | Logistik
  121. Lkw Fahrer (m/w/d)* | C/CE | für Baustoffe
  122. Kranwagenfahrer (m/w/d)* | CE | Nah- und Fernverkehr
  123. Lkw Fahrer (m/w/d)* | C | Lebensmitteltransporte
  124. Berufskraftfahrer (m/w/d)* | CE | Ausfuhr von Heizöl
  125. Berufskraftfahrer (m/w/d)* | CE | Ausfuhr von Heizöl
  126. Lkw Fahrer (m/w/d)* | C | Nahverkehr
  127. Kranwagenfahrer (m/w/d)* | CE | Baustoffe
  128. Lkw Fahrer (m/w/d)* | CE | Fensterbau
  129. Berufskraftfahrer (m/w/d)* | CE | Lebensmitteltransporte
  130. Berufskraftfahrer (m/w/d)* | CE | Lebensmitteltransporte
  131. Lkw Fahrer (m/w/d)* | CE | Entsorgung
  132. Berufskraftfahrer (m/w/d)* | CE | Belieferung von Tankstellen mit Kraftstoff im 2-Schichtdienst
  133. Berufskraftfahrer (m/w/d)* | CE | Belieferung von Tankstellen mit Kraftstoff im 2-Schichtdienst
  134. Berufskraftfahrer (m/w/d)* | CE | Nah- und Fernverkehr
  135. Berufskraftfahrer (m/w/d)* | CE | Planensattel | Containerchassis | Silozüge
  136. Referenzen
  137. Preise und Produkte
  138. Quick
  139. Basic
  140. TOP JOB
  141. Kundenstimmen
  142. Jobletter Jobs für LKW Fahrer per E-Mail
  143. Magazin News für Fernfahrer
  144. Lenk- und Ruhezeiten für Lkw-Fahrer: Was während der Arbeitszeit erlaubt ist und was nicht.
  145. LKW Fahrermangel: Tausende LKW Fahrer fehlen. Sind Arbeitskräfte aus Nicht-EU-Ländern die Lösung?
  146. Containertrucking: Der kombinierte Verkehr macht den weltweiten Güterhandel so effizient.
  147. Berufskraftfahrer Gehalt - Was verdient ein LKW Fahrer wo?
  148. LKW Mautgebühren - So sparen Sie Geld auf Europas Autobahnen.
  149. Kraftverkehrsmeister werden - Die Weiterbildung zum Kraftverkehrsmeister
  150. Folgen Sie LKW-FAHRER-GESUCHT
  151. Loading...

H3 Headings

8 :
  1. Heißt es auf LKW-Fahrer-gesucht.com: "Lkw Fahrer gesucht.", dann werden auch LKW Fahrer gesucht.
  2. Schnell, kurz und gut.
  3. Einfach mehr erreichen.
  4. Unser Top Seller
  5. Kontakt
  6. Magazin
  7. Du bis LKW Fahrer?
  8. Einfach Fahrer finden

H4 Headings

7 :
  1. Service: 040 - 60 94 55 30
  2. € 99 .00 netto
  3. 14 Tage online Endet automatisch KEIN ABO
  4. € 149 .00 netto
  5. 30 Tage online Endet automatisch KEIN ABO
  6. € 239 .00 netto
  7. 30 Tage online auf der Startseite Endet automatisch KEIN ABO

H5 Headings

1 :
  1. Service: 040 - 60 94 55 30

H6 Headings

0 :


2 :

Total Images

335 :

Google Adsense

Not Applicable

Google Analytics

Not Applicable

Links - Internal

  1. Wechselbrückenfahrer
    http://bkf-stellenmarkt.de/lkw-fahrer-jobs/suche.html?q= Wechselbrückenfahrer
  2. Tankwagenfahrer
  3. Speditionsfahrer
  4. Sattelzugfahrer
  5. Gefahrgutfahrer
  6. Schwertransport Jobs
  7. Trucker Jobs
  8. Kipperfahrer
  9. LKW Fahrer gesucht München
  10. Stellenangebote LKW Fahrer Hamburg
  11. LKW Fahrer Jobs Berlin
  12. Lasterfahrer Augsburg
  13. BKF Regensburg
  14. Köln
  15. Lastwagenfahrer Stuttgart
  16. Lastkraftwagenfahrer Dortmund
  17. BKF Frankfurt
  18. Speditionsfahrer Kassel
  19. Automobilogistik Bremen
  20. Lkw Fahrer Jobs Nürnberg
  21. Auslieferungsfahrer
  22. LKW Fahrer Jobs
  23. Servicefahrer
  24. Stellenanzeige schalten
  25. Berufskraftfahrer Stellenangebote Newsletter
  26. Bewerbung als Kraftfahrer
  27. Truckerbörse
  28. No text
  30. Verzeichnis
  31. Magazin
  32. Meine Merkliste
  34. LOGIN
  35. Nahverkehr
  36. Fernverkehr
  37. International
  38. Ausbildungsplätze
  39. Bewerber-Profile
  40. Fahrerbörse durchsuchen
  41. Bewerbung als LKW Fahrer hinterlegen
  43. Jetzt Anzeige schalten
  44. Stellenanzeigen die funktionieren
  45. Zielgruppe und Reichweite
  46. Ihre Stellenanzeige auf Facebook
  47. Stellenanzeigen schreiben = Raketentechnik?
  48. Kundenstimmen
  49. Formate & Preise
  50. Fahrerbörse - LKW Fahrer sucht Arbeit
  51. No text
  52. Stellenangebote Lkw Fahrer Nahverkehr
  53. Fernfahrer Jobs (nat. FV)
  54. Fernfahrer gesucht (int. FV)
  55. LKW Fahrer werden
  56. No text
  57. Fernfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  58. Sünkler Spedition + Transportlogistik GmbH
  59. Berlin
  60. No text
  61. LKW-Fahrer (m/w/d) für Werksverkehr
  62. Schäflein Transport GmbH
  63. Röthlein
  64. No text
  65. Lkw Fahrer (m/w/d)* | C | für die Auslieferung
  66. Getränke Geins GmbH
  67. Barbing
  68. No text
  69. Lkw Fahrer (m/w/d)* | CE | Lebensmittel-Transporte
  70. Schneider Logistik GmbH
  71. Baden-Württemberg
  72. No text
  73. Auslieferungsfahrer/Lkw-Fahrer (m/w/d)* | CE | Textiltransporte
  74. Elis Deutschland
  75. 15517 Fürstenwalde/Spree
  76. No text
  77. Lkw Fahrer (m/w/d)* | CE | Auslieferung
  78. WIBA Paletten GmbH
  79. 69469 Weinheim
  80. No text
  81. Lkw Fahrer (m/w/d)* | CE | nat. FV
  82. Hubert Wagner Transporte
  83. 76275 Ettlingen
  84. No text
  85. Berufskraftfahrer (m/w/d)* | CE | Nah- und Fernverkehr
  86. Bürder Logistics Solutions
  87. 48712 Gescher
  88. No text
  89. Lkw Fahrer (m/w/d)* | CE | Nah- und Fernverkehr
  90. Rolf Smeets Transporte
  91. 47805 Krefeld
  92. No text
  93. Lkw Fahrer (m/w/d)* | CE | Volumentransporte
  94. Reining Transport GmbH
  95. Deutschland
  96. No text
  97. Gefahrgutfahrer (m/w/d)* | CE | ADR Gefahrgut
  98. OCO Ortenauer Gase GmbH
  99. 77963 Schwanau
  100. No text
  101. Lkw Fahrer (m/w/d)* | C1, C, C1E, CE | Baustoffe
  102. KRAFT Baustoffe GmbH
  103. 80807 München
  104. Auslieferungsfahrer/Lkw-Fahrer (m/w/d)* | CE | Textiltransporte
  105. Wismar
  106. No text
  107. Berufskraftfahrer in Vollzeit (m/w/d)* | CE | Tagestouren - Baustoffe
  108. WeGo Systembaustoffe GmbH
  109. Hanau
  110. No text
  111. Berufskraftfahrer (m/w/d)* | CE | Auslieferung | Linienverkehr in Tag- und Nachtschicht
  112. FZ Logistik GmbH
  113. 31224 Peine
  114. Auslieferungsfahrer (m/w/d)* | C | Auslieferung
  115. 31180 Giesen
  116. No text
  117. Lkw Fahrer (m/w/d)* | CE | Getränke
  118. Göttsche Getränke GmbH & Co. KG
  119. Hamburg
  120. No text
  121. Lkw Fahrer (m/w/d)* | CE | Getränke
  122. Quandt Getränke Vertriebsgesellschaft mbH
  123. Geesthacht
  124. No text
  125. Kraftfahrer (m/w/d)* | CE | Koffersattel, Intern. Fernverkehr, 5 Tage Woche
  126. G&B Logistics GmbH
  127. 41844 Wegberg
  128. No text
  129. Lkw Fahrer (m/w/d)* | C | Arbeitsbühnen- & Staplervermietung
  130. Gerken Arbeitsbühnen GmbH
  131. 40599 Düsseldorf
  132. No text
  133. Kraftfahrer (m/w/d)* | CE | nationaler Fernverkehr
  134. Spedition HOMTRANS Service
  135. 18196 Dummerstorf
  136. Berufskraftfahrer in Vollzeit (m/w/d)* | CE | Tagestouren - Baustoffe
  137. Paderborn
  138. No text
  139. LKW Fahrer | Kraftfahrer (m/w/d)* | CE | 450€ Basis | Getränke
  140. Getränke Hoffmann GmbH
  141. No text
  142. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  143. Hermann Bussmann GmbH
  144. Vreden
  145. No text
  146. Lkw Fahrer (m/w/d)* | CE | Lebensmittel-Transporte
  147. Meyer Logistik - Ludwig Meyer GmbH & Co. KG
  148. 27367 Sottrum
  149. No text
  150. Berufskraftfahrer (m/w/d)* | CE | Schüttgüter
  151. Eichelberger Transporte GmbH
  152. 76532 Baden-Baden
  153. No text
  154. Lkw Fahrer (m/w/d)* | CE | Baustoffe
  155. Sievert Logistik SE
  156. 85098 Großmehring
  157. No text
  158. Kraftfahrer (m/w/d)* | CE | ADR Gefahrgut
  159. DEFRU Logistik
  160. 47167 Duisburg
  161. Lkw Fahrer (m/w/d)* | CE | Lebensmittel
  162. Nordrhein-Westfalen
  163. No text
  164. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr
  165. Wolfgang Thielen Logistik
  166. 54516 Wittlich
  167. No text
  168. Lkw Fahrer (m/w/d)* | C | Logistik
  169. Janssen GmbH Logistics and Service
  170. 23738 Lensahn
  171. No text
  172. Kraftfahrer (m/w/d)* | C und CE | Lebensmitteltransporte
  174. 92421 Schwandorf
  175. Kraftfahrer (m/w/d)* | C und CE | Lebensmitteltransporte
  176. 04626 Schmölln
  177. No text
  178. Berufskraftfahrer (m/w/d)* | CE | Wechselbrücken | Drehschemel | Nah + Fernverkehr | Tag + Nacht
  179. Rebro Transport Service GmbH
  180. Krefeld
  181. Berufskraftfahrer (m/w/d)* | CE | Wechselbrücken | Drehschemel | Nah + Fernverkehr | Tag + Nacht
  182. Duisburg
  183. No text
  184. Kraftfahrer (m/w/d)* | CE | Nahverkehr
  185. Sven Walter Logistik e.K.
  186. 06188 Landsberg
  187. Lkw Fahrer (m/w/d)* | CE | Nahverkehr
  188. 99334 Amt Wachsenburg
  189. Kraftfahrer (m/w/d)* | CE | Nah- und Fernverkehr
  190. 12685 Berlin
  191. No text
  192. Kraftfahrer (m/w/d)* | CE | nat. FV
  193. Spedition Kay Schultz
  194. Schleswig-Holstein
  195. No text
  196. Berufskraftfahrer (m/w/d)* | C | Logistik
  197. Schwenk Logistik
  198. Ganderkesee
  199. No text
  200. Auslieferungsfahrer (m/w/d)* | C | Fruchtimporte
  201. Rolf Oertel GmbH
  202. 04158 Leipzig
  203. No text
  204. Berufskraftfahrer (m/w/d)* | C | Nahverkehr
  205. TEMA Transport & Logistik GmbH
  206. 78658 Zimmern ob Rottweil
  207. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  208. 24558 Henstedt-Ulzburg
  209. No text
  210. Lagerist | Kraftfahrer (m/w/d)* | C1E | Belieferung von Baustellen
  211. H. O. Schlüter GmbH
  212. 19386 Lübz
  213. No text
  214. Berufskraftfahrer (m/w/d)* | CE | Belieferung von Tankstellen mit Kraftstoff im 2-Schichtdienst
  215. MF Mineralöl-Logistik GmbH
  216. Nossen
  217. Berufskraftfahrer (m/w/d)* | CE | Belieferung von Tankstellen mit Kraftstoff im 2-Schichtdienst
  218. Emleben
  219. No text
  220. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  221. Halsped GmbH
  222. 04329 Leipzig
  223. No text
  224. Lkw Fahrer (m/w/d)* | CE | Nah- und Fernverkehr
  225. Getränke Reitschuster GmbH
  226. Amerdingen
  227. No text
  228. Berufskraftfahrer (m/w/d)* | CE | Nah- und Regionalverkehr
  229. WKL GmbH
  230. 46149 Oberhausen
  231. Berufskraftfahrer (m/w/d)* | CE | Nah- und Regionalverkehr
  232. 64584 Biebesheim am Rhein
  233. No text
  234. Kranwagenfahrer (m/w/d)* | CE | Baustoffe
  235. team baucenter GmbH & Co. KG
  236. Waren
  237. No text
  238. Kraftfahrer (m/w/d)* für Sattel oder Hängerzug im Nahverkehr
  239. Spedition Schiffers GmbH
  240. 41238 Mönchengladbach
  241. No text
  242. Kraftfahrer (m/w/d)* | CE | Eisen- bzw. Stahltransporte
  243. DiBo trans
  244. 34260 Kaufungen
  245. No text
  246. Kraftfahrer (m/w/d)* | CE | Containertransporte
  247. Grillmayer Transport & Logistik GmbH
  248. 61118 Bad Vilbel
  249. No text
  250. Kraftfahrer (m/w/d)* | CE | Nahverkehr
  251. Fuchs Transporte GmbH
  252. No text
  253. Kraftfahrer (m/w/d)* | CE | Lebensmitteltransporte
  254. Nickel & Goeldner Spedition GmbH
  255. 13127 Berlin
  256. Kraftfahrer (m/w/d)* | CE | Lebensmitteltransporte
  257. Oranienburg
  258. Berufskraftfahrer (m/w/d)* | CE | Kühl- und Frischgut-Transporte
  259. Nickel & Goeldner Spedition GmbH
  260. 19306 Neustadt-Glewe
  261. Auslieferungsfahrer (m/w/d)* | CE | Kühl- und Frischgut-Transporte
  262. 14979 Großbeeren
  263. No text
  264. Kraftfahrer (m/w/d)* CE für Fahrmischer
  266. Dohna
  267. No text
  268. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  269. Adam Offergeld Spedition
  270. Würselen
  271. No text
  272. Lkw Fahrer (m/w/d)* | CE | Nah- und Fernverkehr
  273. Knüppel Verpackung GmbH & Co. KG
  274. 34346 Hann. Münden
  275. No text
  276. Berufskraftfahrer (m/w/d)* | C1E | Stückgut
  277. Transporte Nikolaus Windsperger
  278. 81677 München
  279. No text
  280. Berufskraftfahrer (m/w/d)* | CE | Eisen- bzw. Stahltransporte
  281. Spedition Enzian
  282. 44141 Dortmund
  283. No text
  284. Lkw Fahrer (m/w/d)* | CE | Sattel & Hänger
  285. LOG-IN Int. Spedition GmbH
  286. Bayern
  287. No text
  288. Lkw Fahrer (m/w/d)* | CE | Fernverkehr Deutschland
  289. Herbst Transporte GmbH
  290. 96052 Bamberg
  291. No text
  292. Berufskraftfahrer (m/w/d)* | CE | ADR Gefahrgut
  293. Sauerstoffwerk Steinfurt E.Howe GmbH & Co. KG
  294. 48565 Steinfurt
  295. Auslieferungsfahrer/Lkw-Fahrer (m/w/d)* | CE | Textiltransporte
  296. 07806 Neustadt an der Orla
  297. No text
  298. Auslieferungsfahrer (m/w/d)* | C | Logistik
  299. Rexel Germany GmbH & Co. KG
  300. 01454 Radeberg
  301. No text
  302. Lkw Fahrer (m/w/d)* | CE | Nah- und Fernverkehr
  303. Jäger Transport GmbH, Bochum
  304. 44867 Bochum
  305. No text
  306. Lkw Fahrer (m/w/d)* | CE | Betonwaren
  307. Edmund Knorr & Co. GmbH
  308. Heinsberg
  309. No text
  310. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  311. Güterkraftverkehr Johann Vogl
  312. No text
  313. Kraftfahrer (m/w/d)* | C1E/CE + Eintrag 95
  314. MAX-Logistik GmbH
  315. 48308 Senden
  316. No text
  317. Lkw Fahrer (m/w/d)* | CE | Baustellenverkehr
  318. WBW GmbH
  319. 26826 Weener
  320. No text
  321. Tankwagenfahrer (m/w/d)* | CE | ADR Gefahrgut
  322. Bartosch Energie GmbH
  323. No text
  324. Kraftfahrer (m/w/d)* | B - C1 - C - CE | Auslieferung | Berlin & Brandenburg
  325. Feddersen Gastro GmbH
  326. No text
  327. Berufskraftfahrer (m/w/d)* | CE | Autotransporte
  328. AutoTRANS Schmidt GmbH
  329. Barleben
  330. No text
  331. Berufskraftfahrer (m/w/d)* | CE | Planensattel
  332. Weske GmbH
  333. Haan
  334. No text
  335. Fernfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  336. Kaufmann Spedition GmbH
  337. 30457 Hannover
  338. No text
  339. Fernfahrer (m/w/d)* | CE | Spezial- bzw. Schwerlasttransporte
  341. 89415 Lauingen
  342. No text
  343. Berufskraftfahrer (m/w/d)* | CE | Baustoffe
  344. Gille - Hermann Jenssen GmbH
  345. Bremen
  346. Auslieferungsfahrer/Lkw-Fahrer (m/w/d)* | CE | Textiltransporte
  347. 68169 Mannheim
  348. No text
  349. Kraftfahrer (m/w/d)* | CE | Auslieferung
  350. W. Hartmann & Co. (GmbH & Co. KG)
  351. 22113 Oststeinbek
  352. No text
  353. Berufskraftfahrer (m/w/d)* | CE | Nah- und Fernverkehr
  354. Zschiegner Transporte e.K.
  355. 50739 Köln
  356. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  357. 22844 Norderstedt
  358. No text
  359. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  361. 06679 Hohenmölsen
  362. No text
  363. Berufskraftfahrer (m/w/d)* | CE | Fernverkehr Deutschland
  364. Reese Gruppe
  365. Niedersachsen
  366. No text
  367. LKW-Fahrer / Monteur Verkehrstechnik (m/w/d)* | CE | Traffic Systeme
  368. SWARCO Traffic Systems
  369. Haiger
  370. No text
  371. Auslieferungsfahrer (m/w/d)* | C | Werks- Nahverkehr Reinickendorf
  372. Steineckes Heidebrotbackstube
  373. 13407 Berlin
  374. Lkw Fahrer (m/w/d)* | C | Lebensmitteltransporte
  375. 61191 Rosbach
  376. Lkw Fahrer (m/w/d)* | C | Lebensmitteltransporte
  377. 65479 Raunheim
  378. No text
  379. Kraftfahrer (m/w/d)* | CE | Kühl- und Frischgut-Transporte
  380. Schilling Transport GmbH
  381. 97320 Mainstockheim
  382. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  383. 66386 Sankt Ingbert
  384. Lkw Fahrer (m/w/d)* | C | Logistik
  385. 04552 Borna
  386. No text
  387. Lkw Fahrer (m/w/d)* | CE | Nahverkehr
  388. Go Work Solutions Deutschland GmbH
  389. 41466 Neuss
  390. No text
  391. Lkw Fahrer (m/w/d)* | CE | Abroller | Absetzer | Sattelkipper | Saug- u. Spülwagen | Betonmischer
  392. Neumann PersonalManagement GbR
  393. 64589 Stockstadt am Rhein
  394. No text
  395. Lkw Fahrer (m/w/d)* | CE | Baustoffe
  396. Weichelt Transporte
  397. No text
  398. Lkw Fahrer (m/w/d)* | CE | Silo
  399. S & K Transport GmbH
  400. 32791 Lage
  401. Lkw Fahrer (m/w/d)* | C | Logistik
  402. 13597 Berlin
  403. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  404. 78183 Hüfingen
  405. No text
  406. Berufskraftfahrer (m/w/d)* | C-CE | Lebensmitteltransporte
  407. Backring Nord E. May GmbH & Co. KG
  408. 26789 Leer
  409. No text
  410. Berufskraftfahrer (m/w/d)* | CE | nationaler Fernverkehr
  411. TT Transporte
  412. 20539 Hamburg
  413. Lkw Fahrer (m/w/d)* | CE | Lebensmitteltransporte
  414. Lkw Fahrer (m/w/d)* | C | Lebensmitteltransporte
  415. 15537 Grünheide
  416. Lkw Fahrer (m/w/d)* | C | Lebensmitteltransporte
  417. 16515 Oranienburg
  418. No text
  419. Auslieferungsfahrer (m/w/d)* | CE | Nahverkehr
  420. WIEDEMANN GmbH & Co. KG
  421. Gütersloh
  422. No text
  423. Kraftfahrer (m/w/d)* | CE | Kühl- und Frischgut-Transporte
  424. SCHWÄLBCHEN Frischdienst Südwest GmbH
  425. 74360 Ilsfeld
  426. No text
  427. Kraftfahrer (m/w/d)* | C | Recycling
  428. KNETTENBRECH + GURDULIC Rhein-Neckar GmbH
  429. 68159 Mannheim
  430. Kraftfahrer (m/w/d)* | CE | Recycling | Absetzkipper
  431. No text
  432. Lkw Fahrer (m/w/d)* | CE | ADR Gefahrgut
  433. Orm Bergold Chemie GmbH & Co. KG
  434. 44787 Bochum
  435. No text
  436. Lkw Fahrer (m/w/d)* | CE | Entsorgung
  437. NaBrHo GmbH – natürlicher Brennstoff Holz
  438. Anhausen
  439. Lkw Fahrer (m/w/d)* | CE | Lebensmittel
  440. 31867 Lauenau
  441. No text
  442. Lkw Fahrer (m/w/d)* | CE | Fernverkehr Deutschland
  443. S-D-S Transport & Logistik
  444. 33332 Gütersloh
  445. Berufskraftfahrer (m/w/d)* | C1 | Nahverkehr
  446. 65760 Eschborn
  447. Berufskraftfahrer (m/w/d)* | CE | Nahverkehr
  448. 24534 Neumünster
  449. No text
  450. Fernfahrer (m/w/d)* | CE | Kühl- und Frischgut-Transporte
  451. Valentiner Transport & Logistik
  452. 14974 Ludwigsfelde
  453. No text
  454. Kraftfahrer (m/w/d)* CE für Silozementzug
  455. BERGER BETON SE - Großlehna
  456. Markranstädt
  457. Berufskraftfahrer in Vollzeit (m/w/d)* | CE | Tagestouren - Baustoffe
  458. Leipzig
  459. No text
  460. Kraftfahrer (m/w/d)* | CE | Logistik
  461. R. Apel Transport GmbH
  462. Bremerhaven
  463. Kraftfahrer (m/w/d)* | CE | Logistik
  464. 34123 Kassel
  465. No text
  466. Lkw Fahrer (m/w/d)* | C/CE | für Baustoffe
  467. GIMA GmbH & Co. KG
  468. 41564 Kaarst
  469. No text
  470. Kranwagenfahrer (m/w/d)* | CE | Nah- und Fernverkehr
  471. Reinefeld Transporte
  472. Lkw Fahrer (m/w/d)* | C | Lebensmitteltransporte
  473. 56070 Koblenz
  474. Berufskraftfahrer (m/w/d)* | CE | Ausfuhr von Heizöl
  475. Karlsruhe
  476. Berufskraftfahrer (m/w/d)* | CE | Ausfuhr von Heizöl
  477. Stuttgart
  478. Lkw Fahrer (m/w/d)* | C | Nahverkehr
  479. Siegen
  480. No text
  481. Kranwagenfahrer (m/w/d)* | CE | Baustoffe
  482. Baustoff Mill GmbH
  483. 97833 Frammersbach
  484. No text
  485. Lkw Fahrer (m/w/d)* | CE | Fensterbau
  486. Win-Tec GmbH (Fensterbau)
  487. Oberhausen
  488. Berufskraftfahrer (m/w/d)* | CE | Lebensmitteltransporte
  489. 01683 Nossen
  490. Berufskraftfahrer (m/w/d)* | CE | Lebensmitteltransporte
  491. 06796 Brehna
  492. No text
  493. Lkw Fahrer (m/w/d)* | CE | Entsorgung
  494. KOPP Umwelt GmbH
  495. 65321 Heidenrod
  496. Berufskraftfahrer (m/w/d)* | CE | Belieferung von Tankstellen mit Kraftstoff im 2-Schichtdienst
  497. 49808 Lingen
  498. Berufskraftfahrer (m/w/d)* | CE | Belieferung von Tankstellen mit Kraftstoff im 2-Schichtdienst
  499. 50321 Brühl
  500. No text
  501. Berufskraftfahrer (m/w/d)* | CE | Nah- und Fernverkehr
  502. Peitz Transporte GmbH
  503. 30855 Langenhagen
  504. No text
  505. Berufskraftfahrer (m/w/d)* | CE | Planensattel | Containerchassis | Silozüge
  506. Öttinger Int. Gütertransporte
  507. 74626 Bretzfeld
  508. Alle LKW Fahrer Jobs
  509. Preise ansehen
  510. Freie Fahrer finden
  511. günstig: nur 149 € netto
  513. Ihr Logo hier!
  514. No text
  515. No text
  516. No text
  517. Quick Schnell, kurz und gut. Nutzen Sie gut 94.765* relevante Visits auf LKW-Fahrer-gesucht.com € 99 .00 netto 14 Tage online Endet automatisch KEIN ABO Bewerberpool - Fahrerprofile ansehen und Fahrer kontaktieren Veröffentlichung im Job-Newsletter Jobbörsen Turbo = 13,7 Mio Visits/Monat im Stellenbörsen-Netzwerk Anzeige schalten
  518. Basic Einfach mehr erreichen. Profitieren Sie von 242.391* Besuchen Ihrer Zielgruppe auf LKW-Fahrer-gesucht.com € 149 .00 netto 30 Tage online Endet automatisch KEIN ABO alle QUICK-Vorteile PLUS: Logo + Imagebild = Mehr Leser und Bewerber dank Logo und Bild Integration Facebook-Post (44.013+ Fans/Fahrer) 14-tägiger Refresh Anzeige schalten
  519. TOP JOB Unser Top Seller Über 495.337* relevante Impressionen auf LKW-Fahrer-gesucht.com (*IVW geprüft) € 239 .00 netto 30 Tage online auf der Startseite Endet automatisch KEIN ABO alle QUICK & BASIC-Vorteile PLUS: auf Wunsch: Übernahme Ihrer gestalteten HTML-Design-Anzeige Top Job. Doppelt so viele Leser dank TOP-Platzierung und Hervorhebung auf LKW-Fahrer-gesucht.com Regio-Push Online-Anzeigen in Ihrer Region (Einsatzort). 7-täglicher Refresh (Ihre Anzeige wird nach oben geschoben.) Anzeige schalten
  520. Weitere Informationen
  521. Schreiben Sie uns eine Email
  522. No text
  523. Lenk- und Ruhezeiten für Lkw-Fahrer: Was während der Arbeitszeit erlaubt ist und was nicht.
  524. Caro Schlamp
  525. Weiter lesen
  526. No text
  527. LKW Fahrermangel: Tausende LKW Fahrer fehlen. Sind Arbeitskräfte aus Nicht-EU-Ländern die Lösung?
  528. Weiter lesen
  529. No text
  530. Containertrucking: Der kombinierte Verkehr macht den weltweiten Güterhandel so effizient.
  531. Weiter lesen
  532. No text
  533. Berufskraftfahrer Gehalt - Was verdient ein LKW Fahrer wo?
  534. Eric Jessen
  535. Weiter lesen
  536. No text
  537. LKW Mautgebühren - So sparen Sie Geld auf Europas Autobahnen.
  538. Weiter lesen
  539. No text
  540. Kraftverkehrsmeister werden - Die Weiterbildung zum Kraftverkehrsmeister
  541. Weiter lesen
  542. No text
  543. No text
  544. Kontakt
  545. Durchstarten mit der perfekten Bewerbung
  546. Mach die Berufskraftfahrer Ausbildung und steuere in eine spannende Zukunft!
  547. Fahren ohne Fahrerkarte ist kein Kavaliersdelikt.
  548. Die Nutzung der Lkw Fahrerkarte im Güterverkehr ist Pflicht. Doch die Kosten verbleiben beim Fahrer.
  549. Ohne Fahrerkarte keine Tour. Wichtige Gründe für die rechtzeitige Verlängerung!
  550. Impressum
  551. Nutzungsbedingungen
  552. Datenschutz
  553. Jobletter
  554. Sitemap
  555. Job Feed

Links - Internal (nofollow)


Links - Outbound

  1. (ivw-geprüft)
  2. Facebook-Fanpage
  3. No text
  4. No text
  5. No text
  6. No text
  7. No text
  8. No text
  9. Kerkhoff Transporte
  10. Cosentino Deutschland
  11. No text

Links - Outbound (nofollow)

  1. Cosentino Deutschland

Keyword Cloud for Bkf-stellenmarkt.de

firma meyer logistikzeitpunkt sieteam amfahrerkartenewslettertagetransporteknettenbrech gurdulic rheinneckargurdulic rheinneckarc lebensmitteltransporte abumgebung gesucht janssenkraftfahrerstellenmarkt frce textiltransporteautomatisch kein aboautomatischder firma schwenkkraftfahrer mwd cdie aufdiesemkonntenfr unseren standortreturnam rheingmbhwird von derfahrer gesuchtsven walter logistikresonanz aufoder schnellstmglich werdentransport gmbh einmannheimallettbaustoffe wego systembaustoffe94 55janssen gmbhtextiltransporte wir wachsenweiter werdenkranwagenfahrer mwdek einmwd c logistiklkwschwlbchentankstellen mittrucker jobsklnsehr guteder firma svenresonanzknnenlogistik ein berufskraftfahrertt transportedankperwerdenwirdlogisticsschnellstmglich wird vonein kraftfahrerfahrer jobsnickeltagestouren baustoffece baustoffe aberfolgreich2schichtdienst aboberhausenkhlschnellstmglich werden vonc1unsererfz logistik gmbhfirma nickelkranwagenfahrer mwd mitkgmit wohnort hamburgce khltagestouren baustoffe frbambergder firma meyer00deutschland ab sofort1bietetmwd ce baustoffekraftfahrer mwd mitekc logistikfernverkehr abauf dielkwfahrergesuchtcomeineric jessenlkw fahrer gesuchtfunctionmirder firmagmbh cobesetzt5anzeigeunseren standortspeditionlogistik ludwigumgebung gesucht mfberlin und umgebungquickcheckpopupaufgefahrgut abduisburgleipzigfz logistikwir zum nchstmglichenampkranwagenfahrerfernverkehr deutschland abmwd ce nahverkehrder firma nickelwalter logistik ekoblogistik gmbhmodaldialogcsswidthvollzeitrheinneckardsseldorfdeutschland abkurzautomatisch keinim 2schichtdienst ab55 30steinfurteffizientce tagestouren baustoffewerden sie teilce adrwir sindberlin lkw fahrerzum nchstmglichenunternehmenalsgmbh ein kraftfahreroder schnellstmglichifmwd ckraftstoff imbeinah und fernverkehrhamburg lkwlogistik ab sofort2janssenstellenfahrer einstellenfernfahrerwirverkehrberufskraftfahrer mwd frbaustoffe frauslieferungsfahrerzeitpunkt sie alsmwd cegut funktionierthamburg lkw fahrerhamburg und umgebung68159 mannheimfzarbeitco kg einschwlbchen frischdienstein auslieferungsfahrer mwdzumlenkjemandenhaben wirmwd mit wohnortihreeinstellennickel goeldner spedition13127 berlinbertransportgefundenfahrer findenludwig meyergesucht nickel goeldnersven96052 bambergbzwherrsven waltergurdulic rheinneckar gmbhnamefernfahrer mwd ceein berufskraftfahrermonattrafficvon tankstellengmbh logisticsbereitsunsrheinumgebung gesucht meyerregionjessen4gesucht janssen gmbhmymodal modaldialogcsswidth mymodalfahrer mwd cemanmymodalmodalshow mymodaltextiltransporte wirzum 01102020fr berufskraftfahrerspeditionsfahrereinehabenendet automatisch kein040c lebensmitteltransportece fernverkehr deutschlandgesuchtsie teil6zeitpunktsowiegesucht meyerxfr tagestouren baustoffefirma schwenk logistikjobbrsenmwd und ergnzeneinerfirma nickel goeldner9wir sind sehrkranwagenfahrer mwd cetransport logistik gmbhservice ein lkw60 94 55mineralllogistik gmbhlesenberlin lkwmwd fr tagestourenbaustoffe ab sofortbereichsofort oderanzeige schaltenwohnort hamburgdas istce fernverkehrihrermehrfalsefrischdienstwennsystembaustoffe gmbhcoweiter werden siewachsen weiterfernfahrer mwdnickel goeldnerkraftfahrer mwd frvon tankstellen mitschnellstmglichapel transportservice einweiter lesenberufskraftfahrermodaldialogcsswidth mymodalein kranwagenfahrer mwdtransporte einfunction quickcheckpopupreturn falsenutzennabrho gmbhbremenwie sieintmeyer logistikauchschwenk logistik einmwd ce adrimdas hatbewerber30 tage onlinenahverkehr ab sofortludwig meyer gmbh040 60 94fahrerbrsemwd ce auslieferungsie als berufskraftfahrernichtrolffindenoder schnellstmglich wirdergnzen sietransporte gmbh eingesucht schwenk logistikschwenk logistikwarals auslieferungsfahrer mwdlkw fahrerwonbspco kg hamburgwir wachsenstellenanzeigetranstankwagenfahrerstuttgartzufriedenunseres teamszum nchstmglichen zeitpunkthallooranienburgpreisemfergnzen sie unserfr unserpersonalganzfirma svenauslieferungsfahrerlkwfahrer mwdbruttocergnzendefruschnell7wir abwalterzur verstrkung unseresmwdauslieferung ab sofortlebensmitteltransporte abgruppezeitpunkt einentruckerplattformservicenatcaro schlampumgebung gesucht svenfr diemit wohnortbaustoffe wegostellenangeboteein kranwagenfahrerteam am standortsehr zufriedensichunserer erfolgsgeschichte alsderfrischguttransporte ab sofortce adr gefahrgutausfirma janssen gmbhumgebung gesucht speditiondortmundtopsie alsfr denihre lkweinenein lkwumgebung gesucht schwenkadr gefahrgutc1egeschftsfhrerihnenscholz2schichtdienstkraftfahrer mwdco kgadrteil unserer erfolgsgeschichtece getrnkeder firma speditionzurjobmwd ce frdefru logistikvielen dank frfirma meyerbesondersr apelmeyerfunktioniertkarlsruheendet automatischauf lkwfahrergesuchtcomapelanhausenseverstrkungnabrhokraftverkehrportalmwd ce khldie anzeigegesucht janssenverstrkung unsereswkl gmbhstellenmarktjobbrse frmnchenschaltenelis deutschlandspedition gmbh einhallo herr jessenbochummit kraftstoff imunser teamkeinadr gefahrgut abgoeldnerfirma sven walternossenelisbelieferungals auslieferungsfahrereinen kraftfahrerwalter logistikrichtigenbittedank frgesucht mf mineralllogistikbaustoffe fr unserenschmllnfahrer mwd cgefahrgut ab sofortgesucht nickelsupertransporte gmbhgmbh co kgce nahverkehrlogistik ek eintagestourenmwd ce nahfr lkwlkwfahrer mwdwego systembaustoffe gmbhmeyer gmbhsiebasisvielennahfernverkehrab sofort oderunserenchstmglichen zeitpunkt einenruhezeitenim 2schichtdienstce lebensmitteltransporteerfolgsgeschichte als auslieferungsfahrerniederlassungmymodal modaldialogcsswidthschwandorfgoeldner spedition gmbh60 94sofortfr unsgmbh berlinsind sehrtextiltransportevielemwd mitwir wiederpsuchen wir zumrebroberlinwachsen weiter werdence nahwird vongetrnkekmnursuchen zumauch frvon der firmasehrmwd frein lkw fahrerfirma janssenfahrer diehermannlkw fahrer dieludwiggesucht spedition040 60mwd ce lebensmitteltransporteerfolgsgeschichtesind01102020meyer gmbh coschlampein fernfahrer mwdumgebungmwd c lebensmitteltransportece auslieferungkraftverkehrsmeistergesucht schwenksind sehr zufriedenabdeutschlandneue fahrerlogistik gmbh einwohnortlogistik abtransport servicewir habenbewerbungenlkwfahrerlebensmitteltransporte ab sofortgmbh berufskraftfahrer mwdsoumstandortnchstmglichenberufskraftfahrer mwd cemitwerden siemwd ce tagestourentagestouren baustoffe wegokein abogurdulicteams suchen wir8firma mfab demein berufskraftfahrer mwdhallo herruntergmbh ein berufskraftfahrertankstellen mit kraftstofferfolgsgeschichte alsauslieferungsfahrer mwd mitgoeldner speditionnchstmglichen zeitpunktsuchenfernfahrer mwd mitkraftstoff im 2schichtdienstvon derwir konntenmf mineralllogistikwegoeinen kraftfahrer mwdauslieferungsfahrer mwd c94 55 30lkw fahrer jobsfernverkehr ab sofortfreieumgebung gesuchtmeyer logistik ludwigvollzeit mwdunsereszeitpunkt einen kraftfahrerberufskraftfahrer mwd mitwarenweiterknettenbrech gurdulicab sofortrelevanteden0durchwir wachsen weitergesucht mfgutegterkraftverkehrbewerbungericzuesvollzeit mwd cedemstellenanzeigennettosuchen wirce belieferung vonjobbrsesie unser teamteams suchenunser team amgesucht sventeil unsererunserenkrefeldgutce tagestourenbei derjetztdiemalfirma mf mineralllogistikjanssen gmbh logisticsfrknettenbrechvonmf mineralllogistik gmbhgefahrgutonlinegefahrgutfahrerlogoeinfachwklauslieferungsfahrer mwdgesucht meyer logistiknat fvfrischguttransporte abkg ein lkwwerden voncekhl und frischguttransportetransport gmbhwrselen00 nettoberufskraftfahrer mwdteilwgmbh ein lkwdeswerden von derdasssehr gutdie resonanzerhaltensofort oder schnellstmglichmineralllogistikberatunglkw fahrer mwdwir zumunserer erfolgsgeschichteauslieferunggterslohce textiltransporte wirbaustoffe abkassellogistik ludwig meyerdaswiehamburgder firma janssenapel transport gmbhrheinneckar gmbhfr lkw fahrersystembaustofferfirma schwenkkraftstofftankstellenfr tagestourenneuenwiedermwd fr denmehrereihre lkw fahrermwd ce fernverkehrlogistik eince belieferungein kraftfahrer mwdoderfahrermymodalwego systembaustoffeihrneueunsere anzeigeendetals berufskraftfahrerengagiertec logistik abteamfrischguttransportesie teil unsererinhaberunser3belieferung vonauslieferung abhatam standortvarkraftfahrer mwd cedass wirmit kraftstofffirmawachsensuchen wir abbelieferung von tankstellengmbh berufskraftfahrerspedition gmbhschnellstmglich werdenfirma speditionistgmbh einmymodalmodalshowkontakttransport service gmbhnachlogistik ektransport logistik30 tageein fernfahrerfahrer mwd mitce baustoffeberufskraftfahrer in vollzeitwhrendbaustoffemwd ce belieferungkg einichlebensmitteltransportekostenlosenumgebung gesucht nickelgesucht sven walterteamscaroansehenvielen dankmwd ce textiltransporterebro transport servicewirklichmagazinfernverkehr deutschlandnahverkehr abauslieferungsfahrerlkwfahrer mwd cestellenanzeigen frbergerlogistikfr unserenein auslieferungsfahrerkg hamburgsuchen zum nchstmglichensolutionslogistics and serviceabowir suchennchstmglichen zeitpunkt siesie unserjobsce nahverkehr abals berufskraftfahrer mwdschnellstmglich wirdmachtco gmbhtop jobce frtage onlinefvzur verstrkungbisnahverkehrherr jessenrebro transportlkwfahrergesuchtservice gmbhfr ihreamauslieferungsfahrerlkwfahrerder firma mfce lebensmitteltransporte abschwenktag10kraftfahrer stellenangeboter apel transportfahrer mwdgute resonanz

Longtail Keyword Density for Bkf-stellenmarkt.de

von der firma106
mwd mit wohnort102
ab sofort oder100
sofort oder schnellstmglich99
wird von der91
lkw fahrer mwd87
schnellstmglich wird von84
oder schnellstmglich wird84
gmbh co kg44
fahrer mwd mit39
ein lkw fahrer36
fahrer mwd ce34
berufskraftfahrer mwd mit34
berufskraftfahrer mwd ce32
ein berufskraftfahrer mwd26
ludwig meyer gmbh24
meyer gmbh co24
logistik ludwig meyer24
meyer logistik ludwig24
kraftfahrer mwd ce22
kraftfahrer mwd mit18
co kg ein17
ein kraftfahrer mwd17
werden von der16
lebensmitteltransporte ab sofort15
kg ein lkw14
oder schnellstmglich werden14
schnellstmglich werden von14
gmbh ein berufskraftfahrer13
goeldner spedition gmbh12
nickel goeldner spedition12
mf minerall-logistik gmbh12
umgebung gesucht meyer12
gesucht meyer logistik12
gmbh ein kraftfahrer12
der firma meyer12
firma meyer logistik12
fahrer mwd c11
mwd ce nah-11
mwd ce fernverkehr10
ce lebensmitteltransporte ab10
mwd ce lebensmitteltransporte10
fernverkehr ab sofort10
nahverkehr ab sofort9
nah- und fernverkehr9
fr lkw fahrer9
gmbh ein lkw9
ce fernverkehr deutschland9
janssen gmbh logistics8
deutschland ab sofort8
spedition gmbh ein8
lkw fahrer jobs8
fernverkehr deutschland ab8
logistics and service8
60 94 557
berlin und umgebung7
der firma nickel6
walter logistik ek6
sven walter logistik6
94 55 306
berufskraftfahrer mwd fr6
der firma mf6
firma mf minerall-logistik6
mwd ce nahverkehr6
umgebung gesucht mf6
gmbh berufskraftfahrer mwd6
gesucht mf minerall-logistik6
zum nchstmglichen zeitpunkt6
firma nickel goeldner6
lkw fahrer gesucht6
umgebung gesucht nickel6
gesucht nickel goeldner6
logistik ab sofort6
hamburg lkw fahrer5
sind sehr zufrieden5
hallo herr jessen5
vielen dank fr5
ce nahverkehr ab5
baustoffe ab sofort5
hamburg und umgebung5
mit wohnort hamburg5
ce baustoffe ab5
mwd ce baustoffe5
040 60 945
mwd c lebensmitteltransporte5
c lebensmitteltransporte ab5
fr unseren standort5
mwd c logistik5
frischgut-transporte ab sofort5
khl- und frischgut-transporte5
mwd ce khl-5
mwd ce adr5
ce adr gefahrgut5
ergnzen sie unser4
service ein lkw4
der firma janssen4
firma janssen gmbh4
gesucht janssen gmbh4
umgebung gesucht janssen4
von tankstellen mit4
rebro transport service4
transport service gmbh4
transport logistik gmbh4
mwd ce belieferung4
ce belieferung von4
belieferung von tankstellen4
tankstellen mit kraftstoff4
mit kraftstoff im4
kraftstoff im 2-schichtdienst4
im 2-schichtdienst ab4
mwd ce fr4
knettenbrech gurdulic rhein-neckar4
gurdulic rhein-neckar gmbh4
r apel transport4
apel transport gmbh4
c logistik ab4
mwd und ergnzen4
mymodal modal-dialogcsswidth mymodal4
auslieferung ab sofort4
wir zum nchstmglichen4
suchen wir zum4
fz logistik gmbh4
textiltransporte wir wachsen4
auslieferungsfahrer mwd c4
ce textiltransporte wir4
wir wachsen weiter4
wachsen weiter werden4
weiter werden sie4
werden sie teil4
auslieferungsfahrerlkw-fahrer mwd ce4
sie teil unserer4
logistik gmbh ein4
mwd ce textiltransporte4
kraftfahrer mwd fr4
transport gmbh ein4
unserer erfolgsgeschichte als4
erfolgsgeschichte als auslieferungsfahrer4
sie unser team4
als auslieferungsfahrer mwd4
fernfahrer mwd ce4
unser team am4
team am standort4
teil unserer erfolgsgeschichte4
wir sind sehr3
suchen wir ab3
kranwagenfahrer mwd ce3
ein kranwagenfahrer mwd3
kranwagenfahrer mwd mit3
baustoffe fr unseren3
ce tagestouren baustoffe3
tagestouren baustoffe fr3
ihre lkw fahrer3
mwd ce tagestouren3
vollzeit mwd ce3
berufskraftfahrer in vollzeit3
automatisch kein abo3
endet automatisch kein3
30 tage online3
mwd ce auslieferung3
zeitpunkt sie als3
zur verstrkung unseres3
berlin lkw fahrer3
nchstmglichen zeitpunkt sie3
gefahrgut ab sofort3
sie als berufskraftfahrer3
nchstmglichen zeitpunkt einen3
der firma sven3
co kg hamburg3
der firma spedition3
lkw fahrer die3
einen kraftfahrer mwd3
zeitpunkt einen kraftfahrer3
kraftfahrer mwd c3
logistik ek ein3
umgebung gesucht spedition3
suchen zum nchstmglichen3
fernfahrer mwd mit3
ein fernfahrer mwd3
transporte gmbh ein3
mwd fr den3
firma sven walter3
umgebung gesucht sven3
als berufskraftfahrer mwd3
auslieferungsfahrer mwd mit3
mwd fr tagestouren3
fr tagestouren baustoffe3
tagestouren baustoffe wego3
adr gefahrgut ab3
wego systembaustoffe gmbh3
ein auslieferungsfahrer mwd3
teams suchen wir3
gesucht sven walter3
gesucht schwenk logistik3
umgebung gesucht schwenk3
logistik ein berufskraftfahrer3
schwenk logistik ein3
firma schwenk logistik3
der firma schwenk3
baustoffe wego systembaustoffe3
lkw fahrer125
von der108
mwd ce107
ab sofort107
mit wohnort106
der firma106
mwd mit103
sofort oder100
umgebung gesucht100
oder schnellstmglich99
wird von91
fahrer mwd88
schnellstmglich wird84
berufskraftfahrer mwd79
kraftfahrer mwd53
co kg44
gmbh co44
gmbh ein43
ein lkw36
ein berufskraftfahrer26
meyer logistik24
ludwig meyer24
logistik ludwig24
meyer gmbh24
mwd c20
spedition gmbh18
ein kraftfahrer17
kg ein17
werden von17
lebensmitteltransporte ab15
schnellstmglich werden14
fr die14
auslieferungsfahrer mwd14
transport gmbh13
mwd fr13
firma meyer12
gesucht meyer12
mf minerall-logistik12
minerall-logistik gmbh12
ce lebensmitteltransporte12
suchen wir12
nickel goeldner12
goeldner spedition12
vielen dank11
ce nah-11
transporte gmbh11
fernverkehr ab10
logistik gmbh10
ce fernverkehr10
zum nchstmglichen9
fahrer jobs9
fr lkw9
nahverkehr ab9
fernverkehr deutschland9
wir haben9
fernfahrer mwd8
auf lkw-fahrer-gesuchtcom8
gmbh logistics8
deutschland ab8
herr jessen8
janssen gmbh8
94 557
60 947
sehr zufrieden7
fr den7
transport logistik7
nchstmglichen zeitpunkt6
kranwagenfahrer mwd6
schwenk logistik6
ce baustoffe6
fr unseren6
gesucht mf6
tagestouren baustoffe6
wir suchen6
sven walter6
logistik ab6
logistik ein6
firma mf6
walter logistik6
logistik ek6
firma nickel6
gmbh berufskraftfahrer6
fr ihre6
weiter lesen6
gesucht nickel6
ce nahverkehr6
fr unser6
55 306
wir konnten6
fahrer gesucht6
c logistik5
wir wachsen5
sind sehr5
wohnort hamburg5
belieferung von5
hamburg lkw5
werden sie5
baustoffe ab5
040 605
dank fr5
adr gefahrgut5
als auslieferungsfahrer5
hallo herr5
c lebensmitteltransporte5
fahrer einstellen5
unseren standort5
frischgut-transporte ab5
ce khl-5
ce adr5
kraftfahrer stellenangebote5
von tankstellen4
13127 berlin4
ce belieferung4
haben wir4
caro schlamp4
mymodal modal-dialogcsswidth4
modal-dialogcsswidth mymodal4
mymodalmodalshow mymodal4
return false4
das hat4
mit kraftstoff4
wir sind4
rhein-neckar gmbh4
96052 bamberg4
co gmbh4
zur verstrkung4
am rhein4
wkl gmbh4
knettenbrech gurdulic4
gurdulic rhein-neckar4
68159 mannheim4
tage online4
2-schichtdienst ab4
r apel4
apel transport4
im 2-schichtdienst4
fahrer finden4
kraftstoff im4
tankstellen mit4
ce fr4
stellenmarkt fr4
service gmbh4
ergnzen sie4
wir zum4
anzeige schalten4
transporte ein4
ce auslieferung4
elis deutschland4
am standort4
team am4
unser team4
sie unser4
erfolgsgeschichte als4
als berufskraftfahrer4
unserer erfolgsgeschichte4
teil unserer4
sie teil4
weiter werden4
wachsen weiter4
textiltransporte wir4
auslieferung ab4
ce textiltransporte4
auslieferungsfahrerlkw-fahrer mwd4
sie als4
ein auslieferungsfahrer4
firma janssen4
transport service4
rebro transport4
defru logistik4
fz logistik4
jobbrse fr4
gesucht janssen4
service ein4
die resonanz3
gmbh berlin3
dass wir3
lkw-fahrer mwd3
eric jessen3
fr berufskraftfahrer3
die auf3
das ist3
stellenanzeigen fr3
fahrer die3
trucker jobs3
die anzeige3
sehr gut3
unsere anzeige3
wir wieder3
auf die3
ihre lkw3
bei der3
gut funktioniert3
kein abo3
resonanz auf3
wie sie3
auch fr3
gute resonanz3
nat fv3
ein fernfahrer3
sehr gute3
fr uns3
neue fahrer3
top job3
schwlbchen frischdienst3
automatisch kein3
teams suchen3
ce getrnke3
kg hamburg3
firma spedition3
gesucht spedition3
suchen zum3
gefahrgut ab3
unseres teams3
systembaustoffe gmbh3
gesucht schwenk3
zeitpunkt einen3
firma schwenk3
gesucht sven3
ek ein3
einen kraftfahrer3
ab dem3
wego systembaustoffe3
endet automatisch3
verstrkung unseres3
00 netto3
30 tage3
nabrho gmbh3
firma sven3
tt transporte3
berlin lkw3
zum 011020203
baustoffe wego3
vollzeit mwd3
ce tagestouren3
baustoffe fr3
zeitpunkt sie3
ein kranwagenfahrer3
fr tagestouren3
wir ab3
function quickcheckpopup3

Bkf-stellenmarkt.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Bkf-stellenmarkt.de is a scam?

Websites with Similar Names

Lkw Fahrer gesucht - Kraftfahrer Stellenangebote & Lkw Fahrer Jobs

Recently Updated Websites

Teenwilderness.org 2 seconds ago.Da-systems.co.uk 3 seconds ago.Roomtwist.com 3 seconds ago.Spikysnail.com 3 seconds ago.Test-miniprogram.com 5 seconds ago.Kampk2.com 5 seconds ago.Commercialadvantage.com 5 seconds ago.Pccmw.com 5 seconds ago.Workersincarstalkingabout.info 6 seconds ago.Jewelryallure.com 6 seconds ago.Pinenut.com 6 seconds ago.Aspm.org.br 7 seconds ago.Zjjsj.com 7 seconds ago.Dranupamrathod.com 8 seconds ago.Samsonsigns.com 8 seconds ago.Wfipc.net 8 seconds ago.Streambase.com 8 seconds ago.Teksignals.com 9 seconds ago.Molinari.com.br 9 seconds ago.Hostmaster.net 9 seconds ago.Creativeverse.com 9 seconds ago.Bahasikan.com 10 seconds ago.Rarewedding.com 10 seconds ago.Downlowperformance.com 10 seconds ago.Googletasarim.com 10 seconds ago.Enrichmentfellowship.org 11 seconds ago.Hentaiknight.com 11 seconds ago.Thegirlintranslation.com 12 seconds ago.Getsetspine.com 13 seconds ago.Swgafarmcredit.com 13 seconds ago.