Annual Black Hills Film Festival

Safety: Low trust score
Year Founded: 2009
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Annual film festival in the Black Hills that features South Dakota-produced films and films shot on location in South Dakota, among other national and internati



Domain summary

Last updated
2021-06-14
Domain label
blackhillsfilmfestival
Domain extension
org
Domain registered:
2009-09-21
Domain updated:
2020-10-23
Domain expires:
2020-10-23
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Blackhillsfilmfestival.org registered?
A: Blackhillsfilmfestival.org was registered 11 years, 10 months, 1 week, 3 days, 3 hours, 16 minutes, 50 seconds ago on Monday, September 21, 2009.
Q: When was the WHOIS for Blackhillsfilmfestival.org last updated?
A: The WHOIS entry was last updated 9 months, 1 week, 1 day, 3 hours, 16 minutes, 50 seconds ago on Friday, October 23, 2020.
Q: What are Blackhillsfilmfestival.org's nameservers?
A: DNS for Blackhillsfilmfestival.org is provided by the following nameservers:
  • ns1.wix.com
  • ns2.wix.com
Q: Who is the registrar for the Blackhillsfilmfestival.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Blackhillsfilmfestival.org?
A: Blackhillsfilmfestival.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Blackhillsfilmfestival.org each day?
A: Blackhillsfilmfestival.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Blackhillsfilmfestival.org resolve to?
A: Blackhillsfilmfestival.org resolves to the IPv4 address 23.236.62.147.
Q: In what country are Blackhillsfilmfestival.org servers located in?
A: Blackhillsfilmfestival.org has servers located in the United States.
Q: What webserver software does Blackhillsfilmfestival.org use?
A: Blackhillsfilmfestival.org is powered by webserver.
Q: Who hosts Blackhillsfilmfestival.org?
A: Blackhillsfilmfestival.org is hosted by GOOGLE in Iowa, Council Bluffs, United States, 51502.
Q: How much is Blackhillsfilmfestival.org worth?
A: Blackhillsfilmfestival.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Blackhillsfilmfestival.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Blackhillsfilmfestival.org Free SEO Report

Website Inpage Analysis for Blackhillsfilmfestival.org

H1 Headings

3 :
  1. Virtual Festival Presenting Sponsors
  2. Supporting Sponsors
  3. Contributing Sponsors

H2 Headings

1 :
  1. Stu Fromm

H3 Headings

2 :
  1. Sponsorship Information
  2. Please Click here

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

1 :
  1. FOLLOW US:

Total IFRAMEs

1 :

Total Images

18 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

28:

Links - Internal (nofollow)

0:

Links - Outbound

15:

Links - Outbound (nofollow)

0:

Keyword Cloud for Blackhillsfilmfestival.org

255 1antonsansseriffilm festivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilmimpactimpactw012010impactw022010impactw102010sansserif color000000festival south dakotastylejqpua654submenu12px14emstylejr6urii1navcontainerarrowsanssansserifmargin0lineheightnormalletterspacingnormaloverflowhiddennationalother nationalborderstylesolidbordercolorrgba249 249opacity1 ssg1hoverbackgroundcolorrgba219ssg1imageitempanelhelveticaneuew0255roma0neue helveticaneuew0155romafestivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilm festival southiffontnormal8importantleftauto1backgroundcolorrgba255 255 2550px rgba0helveticaneuew1055roma helveticaopacity1dakotaproduced filmspositionfixed importantleftauto importantzindex50stylejqpua654menucontainerleftdirection100width4backgroundcolorrgba199 30 18204 204selectdatapreviewfocus3249 24913px14em open9importantzindex507255 1 stylejr6urii1navcontainersolid rgba0 0normal 13px14emsanssansserif color000000svg05samong otherstylejr6urii1repeaterbuttoninner000000positionstaticboxshadow000 0 0positionfixed importantleftautofilmbackgroundcolorrgba199 30borderwidth2px borderstylesolidbordercolorrgba249calc100 980pxcalc100rgba0 0black hills filmborderwidth2pxbordercolorrgba204hills filmselectease 0spositionfixed2helveticaneuew0155roma1 stylejqpua654menucontainerhillsfilm festivalsolid rgba0color1inscfontsize80px importantvarssg1pnlwidth100height100fontnormal normal normalfestivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilm festivalborderbottomleftradius0borderbottomrightradius0shotpositionabsolutetop0left0color373737width100height1000s stylejr6urii1repeaterbuttondatastateselectedssg1btnblack hillsstylejqpua654itemhoverareafirstchildimportantselectdatapreviewerrortxtnew ul05marginleft calc100backgroundcolorshot on location219 140px14emnormalabsolutetophelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romaotherstylek4u9kos91backgroundcolorrgba255hills film festivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilm3tstqstylejr6urii1navcontainerarrowstylejr6urii1navcontainerrightdirectionneue helveticaneuew0155roma helveticaneuew0255romastylejqpua654menucontainersvgcontaineropen sanssansserif color000000txtnewnormal normal 13px14emopen sanssansserif1inscfontsize80pxhelveticaneuew0255roma helveticaneuew1055romastylejqpua654submenubeforeopacity1 ssg1datastatetouchrolloverstylejr6urii1navcontainerarrow stylejr6urii1navcontainersvgcontainereasedakotaproducedssg1imageitempanel opacity0opacity0south04s ease30 18features south dakotaproducedb0b0b0marginleft1px rgba0 0topautobottom0south dakotaproduced filmsfont normal normalstylejr6urii1repeaterbuttonbg1backgroundcolorrgba255 255transitionopacityssg1buttons opacity11inscfontsize60px important1pxstylek4u9kos9videoplayer2725432193rootselectfocusiframeselecthovermargin0lineheightnormalletterspacingnormal txtnewfeatures southamongstylejqpua654menucontainerarrow stylejqpua654menucontainersvgcontainer04s ease 0s255 1 stylejqpua654menucontainerlocation1 stylejr6urii1navcontainer0px rgba0 0ssg1hover980px 05ssg1pnl opacity11inscfontsize75pxnormal normal 40px14emrgba0neuesouth dakotafeaturesdakota10pxinternatimetakeywordsseopagetitleseoannual black hillsdakota among otherstylejqpua654menucontainerarrowstylejqpua654menucontainerleftdirectionstylejqpua654menucontainerrightdirectionantonsansserif color000000south dakota among0pxease 0s stylejr6urii1repeaterbuttondatastateselectedultxtnew05s ease 0sfilms and filmsstylejqpua654itemhoverarealastchildfilmssolid transparentpositionstaticboxshadow000 0borderstylesolidbordercolorrgba249fontnormal normalselectdatapreviewerror stylejr6urii1navcontainerarrowpositionstaticboxshadow0001inscfontsize75px importantbackgroundcolorrgba199fc3bgnrgba0 0 0normal 40px14emnormal normalhelveticaneuew1055roma helvetica arialssg1autoplay span5oldirrtlffffffhelvetica0shills that featuresssg1helpersimportantleftauto importantzindex5013px14em open sanssansseriffestival southsouth dakotaproducedcontenttransparent1impactimpactw012010impactw022010impactw102010sansserifstylejr6urii1navcontainerarrowstylejr6urii1navcontainerleftdirectionfontopenselectdatapreviewhoverfilms shotfestival219 219stylejr6urii1repeaterbuttondatastateselectedlocation in south4px 0pxborderwidth2pxbordercolorrgba204 204selectdatapreviewerror stylejqpua654menucontainerarrow255 255 1backgroundcolorrgba219 219ulbackgroundcolorrgba219 219 219helveticaneuew1055romacalc100 980px 05helveticaneuew0255roma helveticaneuew1055roma helveticatransitionopacity 05s easeauto0 0spanol ullb1itemscontainersolidpositionabsolutetop0right0bottom0left0font normalcolor ffffffol6internatimetakeywordsseopagetitleseoannual black1inscfontsize60pxborder0px249 1backgroundcolorrgba255 255stylejr6urii1navcontainertransitionopacity 05s0 0 1borderleft0arialstylejqpua654itemstylejqpua654submenu stylejqpua654itemnational and internatimetakeywordsseopagetitleseoannualstylejqpua654menucontainerstylejr6urii1navcontainerarrowstylejr6urii1navcontainercenterdirection249 249 1backgroundcolorrgba255stylejr6urii1navcontainercenterdirectionnormal 13px14em open13px14emstylejqpua654labelselectdataerrortrueborder0px solid0 1stylejqpua654item borderradius0borderradius0stylejr6urii1navcontainerleftdirectionhelvetica arialfacebooklikebox1likeboxcontainer04shelveticaneuew0155roma helveticaneuew0255romassg1buttonsinternatimetakeywordsseopagetitleseoannual1borderradius0ultxtnew ol255 255stylejqpua654menucontainercenterdirection10borderwidth2px borderstylesolidbordercolorrgba249 249displaynone05s easefilm festivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilm festivalstylejr6urii1repeaterbuttonlabelmarginleft calc100 980px219 219 1249 1backgroundcolorrgba2554pxborderstylesolidbordercolorrgba249 249 249stylejqpua654menucontainerarrowstylejqpua654menucontainercenterdirectioncolor000000stylejqpua654menucontainerarrownormal normal normalborderright01px rgba0borderwidth2pxbordercolorrgba204 204 204blackstylejr6urii1repeaterbuttondatastatedropssg1datastatetouchrollover980pxdakota amongfestivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilmborderwidth2pxbackgroundcolor ffffffstylejr6urii1navcontainerrightdirectionstylejr6urii1navcontainersvgcontainerssg1autoplay184 184among other national000stylejqpua654menucontainerarrowstylejqpua654menucontainerrightdirection

Longtail Keyword Density for Blackhillsfilmfestival.org

KeywordsOccurences
calc100 980px 0526
margin-left calc100 980px26
rgba0 0 017
normal normal normal13
normal normal 13px14em13
normal 13px14em open13
font normal normal11
04s ease 0s10
13px14em open sanssans-serif9
fontnormal normal normal8
border-width2px border-stylesolidborder-colorrgba249 2498
border-stylesolidborder-colorrgba249 249 2498
0 0 17
1background-colorrgba255 255 2557
black hills film7
open sanssans-serif color0000007
255 255 17
249 1background-colorrgba255 2556
solid rgba0 06
249 249 1background-colorrgba2556
among other national5
hills that features5
features south dakota-produced5
dakota among other5
south dakota among5
south dakota-produced films5
films and films5
location in south5
shot on location5
neue helveticaneuew01-55roma helveticaneuew02-55roma5
helveticaneuew02-55roma helveticaneuew10-55roma helvetica5
helveticaneuew10-55roma helvetica arial5
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma5
festival south dakota4
positionstaticbox-shadow000 0 04
border-width2pxborder-colorrgba204 204 2044
219 219 14
05s ease 0s4
1px rgba0 04
festivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilm festival south3
film festivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilm festival3
hills film festivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilm3
internatimetakeywordsseopagetitleseoannual black hills3
national and internatimetakeywordsseopagetitleseoannual3
normal normal 40px14em3
transitionopacity 05s ease3
positionfixed importantleftauto importantz-index503
0px rgba0 03
255 1 style-jqpua654menucontainer3
ease 0s style-jr6urii1repeaterbuttondata-stateselected3
background-colorrgba199 30 183
255 1 style-jr6urii1navcontainer3
background-colorrgba219 219 2193
0 041
normal normal38
980px 0526
margin-left calc10026
calc100 980px26
rgba0 017
ease 0s14
normal 13px14em13
13px14em open13
open sanssans-serif12
black hills12
font normal11
255 25510
04s ease10
hills film10
south dakota9
fontnormal normal9
border-width2px border-stylesolidborder-colorrgba2498
30 188
249 2498
border-stylesolidborder-colorrgba249 2498
219 2198
255 17
1background-colorrgba255 2557
sanssans-serif color0000007
0 17
film festival7
margin0line-heightnormalletter-spacingnormal txtnew7
249 1background-colorrgba2556
1inscfont-size60px important6
204 2046
solid rgba06
1 style-jqpua654menucontainer5
neue helveticaneuew01-55roma5
other national5
among other5
dakota among5
films shot5
dakota-produced films5
south dakota-produced5
features south5
helvetica arial5
helveticaneuew10-55roma helvetica5
helveticaneuew02-55roma helveticaneuew10-55roma5
helveticaneuew01-55roma helveticaneuew02-55roma5
1 style-jr6urii1navcontainer5
solid transparent4
style-jqpua654item border-radius04
positionstaticbox-shadow000 04
05s ease4
1inscfont-size80px important4
antonsans-serif color0000004
ssg1buttons opacity14
opacity1 ssg1data-statetouchrollover4
festival south4
219 14
border-width2pxborder-colorrgba204 2044
1px rgba04
style-jqpua654submenu style-jqpua654item4
txtnew ul4
background-colorrgba219 2193
0px rgba03
color ffffff3
impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif color0000003
internatimetakeywordsseopagetitleseoannual black3
film festivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilm3
184 1843
border0px solid3
normal 40px14em3
festivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilm festival3
ol ul3
transitionopacity 05s3
1inscfont-size75px important3
ssg1autoplay span3
ultxtnew ol3
positionfixed importantleftauto3
importantleftauto importantz-index503
0s style-jr6urii1repeaterbuttondata-stateselected3
selectdata-previewerror style-jr6urii1navcontainerarrow3
style-jr6urii1navcontainerarrow style-jr6urii1navcontainersvgcontainer3
background-colorrgba199 303
style-jqpua654menucontainerarrow style-jqpua654menucontainersvgcontainer3
ssg1imageitempanel opacity03
selectdata-previewerror style-jqpua654menucontainerarrow3
ssg1pnl opacity13
opacity1 ssg1hover3
4px 0px3
background-color ffffff3
093
normal65
background-color37
color36
important35
0527
980px26
margin-left26
calc10026
123
220
style-jqpua654item19
solid18
txtnew18
color00000017
rgba017
316
ease16
opacity116
416
open16
style-jqpua654submenu15
positionabsolutetop0right0bottom0left015
hills15
film15
style-jqpua654menucontainer15
south14
0s14
festival13
13px14em13
style-jr6urii1navcontainer13
512
sanssans-serif12
black12
displaynone11
1px11
style-jr6urii1navcontainerarrow11
ul11
style-jqpua654menucontainerarrow11
font11
style-k4u9kos910
04s10
films10
fontnormal9
3tstq9
dakota9
68
78
border-radius08
border-width2px8
ffffff8
border-stylesolidborder-colorrgba2498
var7
ol7
margin0line-heightnormalletter-spacingnormal7
1background-colorrgba2557
1inscfont-size60px6
style-jr6urii1repeaterbuttonbg6
style-jr6urii1navcontainerarrowstyle-jr6urii1navcontainercenter-direction6
style-jr6urii1navcontainerarrowstyle-jr6urii1navcontainerright-direction6
style-jqpua654menucontainerarrowstyle-jqpua654menucontainerleft-direction6
style-jr6urii1navcontainerarrowstyle-jr6urii1navcontainerleft-direction6
style-jqpua654menucontainerarrowstyle-jqpua654menucontainerright-direction6
selectdata-previewerror6
selectdata-previewhover6
selectfocus6
selectdata-previewfocus6
style-jqpua654menucontainerarrowstyle-jqpua654menucontainercenter-direction6
selectdata-errortrue6
ssg1imageitempanel6
selecthover6
86
arial6
0px6
helveticaneuew02-55roma5
helveticaneuew01-55roma5
neue5
helvetica5
ultxtnew5
ssg1buttons5
style-k4u9kos9videoplayer2725432193root5
helveticaneuew10-55roma5
10px5
features5
transparent5
if5
dakota-produced5
ssg1autoplay5
shot5
location5
among5
other5
national5
opacity04
0004
ssg1data-statetouchrollover4
select4
1inscfont-size80px4
style-jr6urii1repeaterbuttonlabel4
style-jr6urii1repeaterbuttondata-stateselected4
positionstaticbox-shadow0004
05s4
lb1itemscontainer4
b0b0b04
94
0000004
antonsans-serif4
12px14em4
ssg1helpers4
n4
transitionopacity4
positionabsolutetop0left0color373737width100height1004
104
border-width2pxborder-colorrgba2044
100width4
style-jqpua654label4
span4
svg4
style-jqpua654itemhoverarealast-child4
style-jqpua654itemhoverareafirst-child3
style-jqpua654menucontainercenter-direction3
border-right03
1inscfont-size75px3
style-jqpua654menucontainerright-direction3
border-left03
ssg1btn3
40px14em3
border-bottom-left-radius0border-bottom-right-radius03
overflowhidden3
style-jqpua654menucontainerleft-direction3
style-jqpua654menucontainersvgcontainer3
impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif3
style-jqpua654submenubefore3
internatimetakeywordsseopagetitleseoannual3
festivalpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg187imetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresetfalsemobilecustomtruereftypebackgroundmediaidcustombgimgv0zmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitleuri214ec63b86be8b75c276fe06abfb9c8f473244pngwidth1152height864altcolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypemetapropsnamekeywordscontentfilm3
background-colorrgba2193
content3
positionfixed3
auto3
facebooklikebox1likeboxcontainer3
4px3
absolutetop3
ssg1pnl3
iframe3
width100height1003
border0px3
oldirrtl3
background-colorrgba1993
style-jr6urii1navcontainersvgcontainer3
importantleftauto3
style-jr6urii1navcontainerleft-direction3
1border-radius03
style-jr6urii1navcontainerright-direction3
fc3bg3
style-jr6urii1navcontainercenter-direction3
topautobottom03
style-jr6urii1repeaterbuttoninner3
importantz-index503
style-jr6urii1repeaterbuttondata-statedrop3
ssg1hover3

Who hosts Blackhillsfilmfestival.org?

Blackhillsfilmfestival.org Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:GOOGLE
Hosted Country:United StatesUS
Location Latitude:41.2591
Location Longitude:-95.8517
Webserver Software:Not Applicable

Is "GOOGLE" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.2088%
Unknown
5.0138%
AS-26496-GO-DADDY-COM-LLC
4.3256%
NAMECHEAP-NET
3.6268%
AMAZON-AES
2.7254%
GoDaddy.com, LLC
2.4825%
UNIFIEDLAYER-AS-1
2.3319%
Fara Negar Pardaz Khuzestan
1.9947%
CONFLUENCE-NETWORK-INC
1.7092%
1&1 Internet AG
1.6708%

HTTP Header Analysis for Blackhillsfilmfestival.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 14 Jun 2021 12:29:54 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
link:; rel=preconnect; crossorigin;,; rel=preconnect;,; rel=preconnect; crossorigin;,; rel=preconnect; crossorigin;,; rel=preconnect;,; rel=preconnect; crossorigin;,
x-wix-request-id: 1623673794.618411782474131730
content-language: en
strict-transport-security: max-age=120
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVh6aqXNQlfs1DVxLIoL9NTV,qquldgcFrj2n046g4RNSVOgjK1IbQcmp 2yVeKIZh3A=,2d58ifebGbosy5xc FRalnAs/J cLvJXJ3LiSs3pK9EYafTMMqgbCEjYdLuV0ay83fKEXQvQlSAkB/lstal9R01FZ/CPvwy9hq09O84sDQk=,2UNV7KOq4oGjA5 PKsX47PacouZIurdHKYy 3qobDts=,IaDuTAMGGvhXtruM6nHg6jcxQhuKaBlHQOnsUQPN3 aTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,WDMzHiyOL7uW518fW2Byrx1rS8gWv57R8LaWQLMPEOnA/fYSFYZn4zbetbsCAMWaiLmOBCJX9PwPq0FFNfh5cw==,IaDuTAMGGvhXtruM6nHg6jcxQhuKaBlHQOnsUQPN3 aTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,w4q8mm9FnmU4emOs6psVXb3/R xVfv3vhu3iEcpaijuTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LoUK8/saGAmOxZWtpubo2u9Qd2Gs1aZnGfEBoDKXIxglcUi1nqRRpGOvSdDRwJhvjRIGBeKvIiXzb3objiHcCw==,w4q8mm9FnmU4emOs6psVXb3/R xVfv3vhu3iEcpaijuTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,w4q8mm9FnmU4emOs6psVXSfweowBbbde6zqOT6FBb26TzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,/a5ccLSK1HEmwPNg/x6Ouh98uh3reNeZTOFUei8P9vvHMeKVKAb1AuuBWGXnvH2FALT0UNy4OfR5iTGl3vOAnQ==
Vary: Accept-Encoding
cache-control: private,max-age=0,stale-while-revalidate=60
X-Content-Type-Options: nosniff
Content-Encoding: gzip
Server: Pepyaka/1.19.0

Blackhillsfilmfestival.org Domain Nameserver Information

HostIP AddressCountry
ns1.wix.com 185.230.61.165
ns2.wix.com 185.230.60.165


Need to find out who hosts Blackhillsfilmfestival.org?


Domain Registration (WhoIs) information for Blackhillsfilmfestival.org

 Domain Name: BLACKHILLSFILMFESTIVAL.ORG
Registry Domain ID: D157160072-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-09-17T16:46:10Z
Creation Date: 2009-09-21T19:42:37Z
Registry Expiry Date: 2021-09-21T19:42:37Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province: FL
Registrant Country: US
Name Server: NS1.WIX.COM
Name Server: NS2.WIX.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-23T18:43:20Z

Websites with Similar Names

Black----jack.com
Black----Jack.com
Black---jack.com
403 Forbidden
Black--shirtstudio.com
black--shirtstudio.com
Black-0.com
black-0.com
Black-07.com
Access denied | black-07.com used Cloudflare to restrict access
Black-08.com
Access denied | black-08.com used Cloudflare to restrict access
Black-09.com
Access denied | black-09.com used Cloudflare to restrict access

Recently Updated Websites

Ciaobellaskin.club (7 seconds ago.)Koliaskid.ru (8 seconds ago.)Surveymoneynow.xyz (10 seconds ago.)Azchampion.com (11 seconds ago.)Joshwoodcook.com (18 seconds ago.)Parquepatagonianorte.net (26 seconds ago.)Defy.chat (27 seconds ago.)Eacotts.com (29 seconds ago.)Jomoracing.com (29 seconds ago.)Oystermax.com (31 seconds ago.)Elitesocietylondon.co.uk (32 seconds ago.)Calvadosienne.fr (35 seconds ago.)Olivewalthamforest.com (38 seconds ago.)Iphotonews.com (38 seconds ago.)Bemycs.com (40 seconds ago.)Envirosocialhr.com (40 seconds ago.)Naturanews.com (42 seconds ago.)Komondorproperties.com (44 seconds ago.)Dundealy.org (45 seconds ago.)Carlinechronicles.com (49 seconds ago.)Ppsoftware.ch (51 seconds ago.)Mindbodyandme3.com (52 seconds ago.)Aruncadd.com (53 seconds ago.)Ibc.link (55 seconds ago.)Xavierbrotel.com (58 seconds ago.)Servsolutions.tech (59 seconds ago.)Sherealfit.com (1 minute 2 seconds ago.)Groupenterprisellc.com (1 minute 7 seconds ago.)K3-valbyhavedk.com (1 minute 8 seconds ago.)Bizzfit.ca (1 minute 11 seconds ago.)

Recently Searched Keywords

ohne (1 second ago.)arasnda tamaclk yapan (3 seconds ago.)nutribén innova 1 800gr (3 seconds ago.)veg capsules (3 seconds ago.)answer your question (4 seconds ago.)in design blog (4 seconds ago.)recommended dentists in surrey (5 seconds ago.)book virtual office – 200k (5 seconds ago.)trlk bir pazar (5 seconds ago.)комментариев: 2 (5 seconds ago.)remaining stores (6 seconds ago.)по камню (6 seconds ago.)photos (7 seconds ago.)sabias que (8 seconds ago.)themexpose (8 seconds ago.)self-employed (9 seconds ago.)除甲醛 (9 seconds ago.)firma nvanlarnn (9 seconds ago.)dropdown2713770132dropdown dropdownbase3644427161roottpasectionj9zo4ilq dropdownoption978924491dropdownoption (10 seconds ago.)dropdown2713770132dropdown dropdownbase3644427161roottpasectionj9zo4ilq dropdownoption978924491dropdownoption (10 seconds ago.)clothing (10 seconds ago.)2016 ylnda (10 seconds ago.)ayn yl (11 seconds ago.)плаванье (12 seconds ago.)ksrak st (12 seconds ago.)mitchavaisse (14 seconds ago.)марина фомина (15 seconds ago.)in focus (16 seconds ago.)modo eğitim seti türkçe (16 seconds ago.)ve skle (18 seconds ago.)