Registration Date:
Domain Registrar:
Service Provider:, Inc.  Ireland
High trust score
Late Updated:
1 year 7 months ago Website Information

It is a sub-domain of It is the world's 2,441nd most popular site among over 300 million websites. and is hosted by, Inc.. This site has a Google PageRank of 6/10.
It has an estimated worth of $ 4,919,400.00 and has an average daily income of approximately $ 4,555.00. is SAFE to browse as we did not find any active threats.

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:2,441
Majestic Rank Majestic Rank:0
PageSpeed Google PageSpeed:42%
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Social Engagement for

Facebook Shared:0
Facebook Like Count:0
Facebook Comment Count:0
Twitter Tweets:0
LinkedIn Shares:0
Google Plus Shares:57 Traffic Report

Daily Unique Visitors:569,422
Daily Pageviews:4,555,376 Estimated Valuation

Income Per Day:$ 4,555.00
Estimated Worth:$ 4,919,400.00

Search Engine Indexes for

Google Indexed Pages:11,900
Yahoo Indexed Pages:View Yahoo pages
Bing Indexed Pages:View Bing pages
History:View WayBackMachine history

Search Engine Backlinks for

Google Backlinks:52
Bing Backlinks:0
Alexa BackLinks:0

Safety Information for

Google Safe Browsing:No Risk Issues
Siteadvisor Rating:No Risk Issues
WOT Trustworthiness: Excellent
WOT Privacy: Excellent
WOT Child Safety: Excellent

Similarly Ranked Websites to

2,439 - Juegos Gratis, Juegos en linea, Juegos Online, Juego

¡Los juegos más chulos gratis para todo el mundo! Juegos de puzzles, juegos de acción, multijugador y mucho más.

2,440 How-To Help and Videos - For Dummies

Make everything easier in your life with step-by-step instruction, how-to information, and video demonstrations awaiting your discovery at — the online resource for...

2,441 Fortune - Fortune 500 Daily & Breaking Business News

Fortune 500 Daily & Breaking Business News

2,442 Actualité économique, Bourse, Banque en ligne - Boursorama

Découvrez Boursorama, Banque la moins chère et leader de l'information boursière et financière (cours des actions, des indices, des devises, de l'or...)

2,443 手机游戏第一门户网站


Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

No match for domain "BLOG.JETBRAINS.COM".
>>> Last update of whois database: 2017-08-19T13:03:57Z

Who hosts is hosted by, Inc. in Leinster, Dublin, Ireland. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service, Inc.
Hosted Country:IrelandIE
Location Latitude:53.3331
Location Longitude:-6.2489
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Cache-control: no-cache="set-cookie"
Content-Type: text/html; charset=UTF-8
Date: Tue, 16 Feb 2016 10:32:50 GMT
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Link:; rel=""
Pragma: no-cache
Server: nginx
Vary: Cookie
X-Powered-By: PHP/5.3.3
transfer-encoding: chunked
Connection: keep-alive

Need to find out who hosts Free SEO Report

Page Title of

Company Blog

Meta Description of

Meta Tags of

No tags found

Website Inpage Analysis for

H1 Headings:5
Company Blog
Looking back at Hackathon 5
The Prizes on offer
CEO’s Choice Awards
Audience Choice Awards
H2 Headings:29
Official Support for Open-Source Rust Plugin for IntelliJ IDEA, CLion, and Other JetBrains IDEs
JetBrains 5th Annual Hackathon: Logged in History 1st Prize to Ideolog
48 hours
What it takes to code
Grand Prize $5,000 – Ideolog
Second Prize $3,000 – Nomouse
Third Prize $2,000 – Danke/Спасибо/Thanks …
CEO’s Choice Award I $1,000 – Processing for Kotlin as IntelliJ IDEA Plugin
CEO’s Choice Award II $1,000 – Create React Kotlin App
Vanity Stats
Queue Management
Actively used
Not forgetting
The Developer Ecosystem: What is dominant in the world of code
JetBrains elected to the JCP Executive Committee
JetBrains to support the ACM-ICPC
JetBrains Toolbox App 1.3 is here
Global hotkey
Keyboard navigation
Collapsible tools list
Better ReSharper and Visual Studio 2017 support
Animated icon
Anonymous usage statistics
Bug fixes and smaller improvements
Kotlin on Android. Now official
JetBrains Toolbox 2017.1 is here
JetBrains: 2016 in Review
Happy Birthday JetBrains! How old are you?
H3 Headings:7
Current State
Our Plans
“Oh, thank you!! I’m 17, ehm, no 15… well it depends :)”
Search this blog
JetBrains Product Blogs
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:2
Total Images:17
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

buildsfindknowbestideceos choice awardknownproductworkintellijnewwinnersbeforestatsthosetaggedwe8217reus weproductsissueslanguagebugteambecomecheckbothwell92addsprojectsthroughjava community2017 by eugene48opensourcegivedeveloper ecosystemcodedatagripsincetoporovandroidcanuseexecutiveafterdebuggerfeedbackincludinglikemanagementlistdeveloperitscommits1differentcreatedour usersofficeresharpertimebetweenincludehoursidealanguageswesourcehackathonwerefullmouseteamsresponsesdo youfeaturesnumberincredibledevelop postedinternalintoability5thdoprizeseeeducationalglobalaudiencestudio 2017comingwe alsoawardsvisual studio 2017possibleyou haveyou canpythonreport6improvessupportchoice awardinfographicsaddeddevelopmentcoursejustearlyavailablemanycreatevideointellijbasedusingquestionsnews taggedplease5rust pluginbutviewcandreybehindthescenesapplicationsuchblogsearcheasierallgoinginspectionsideologtoolusedclionkeyboardnavigation9 comments2 commentsifjetbrains the drivestatisticsyouprogrammingintellijbased idestoolbox appupdatesspecialeverybeenothertotalthesewe8217veusersintroducedeugeneyour jetbrainsuncategorizedgetusage statisticsmuchonealsoyouropenhave beenposted in newswe believeimportantstartedeugene toporovsystemjetbrainssupportedinsidebirthdaysmallsurveymakeenvironmentsstillthinkbeingbetterthemworldupdateofficesalexeybackhadintellij platformrepresentnexthavedeveloperstouchrustvisual studiotwo daysanyintellij ideaonlynowidessurecurrentlysolveeventsceosupoutnews48 hours10theirreadycheck outourtakingcommitteesodevelopcommentslotusagemaymoreresultsjetbrains toolboxothersif youprizesweveif you havecompanyreacttheyslackkotlinimprovementslognotsoonneeddaysworld finalsanswerentriesicpcplanseventryrequestsfinalshereexistinggreathelppycharmcontestscommunitywe havetoobasedverycovertheregroupsfilesjetpostworkingplatformtworeallynoagewhichwe canstudiofixesunitshouldprogressposted on maydatatestingsergeyfuturespecificquiteexecutive committeehappymadeactiveappframeworkstoolboxannualyearstartmostecfirstmakingchangesgodevelopedofficialus0alwaysannouncereleaseprojectdrive to developunit testingfebruarypostedchoiceoversupportsceos choicethenawardmainlybringsjcpvisualjavaecosystemtoolsprocesssomehasspecificationsusefulcomments jetbrainsnameddrivepeoplepart3set7settingsbelievewantpluginformattingrightwebstormlearning

Longtail Keyword Density for

2017 by eugene5
posted in news4
drive to develop4
jetbrains the drive4
visual studio 20173
posted on may3
if you have3
ceos choice award3
toolbox app12
intellij idea7
do you7
check out6
you can6
jetbrains toolbox6
comments jetbrains5
executive committee5
eugene toporov5
you have5
we have4
intellij-based ides4
visual studio4
choice award4
if you4
develop posted4
ceos choice4
have been3
intellij platform3
48 hours3
we also3
studio 20173
unit testing3
9 comments3
your jetbrains3
usage statistics3
we believe3
java community3
rust plugin3
developer ecosystem3
2 comments3
our users3
us we3
we can3
news tagged3
two days3
world finals3
environments3 Traffic Distributions and Sources Traffic Estimates and Sources

Backlink History Chart for

Referring Domains Discovery Chart for

Backlinks Reviewed Chart for Page Resources Breakdown Homepage Links Analysis

Alexa Traffic Rank for

Alexa Search Engine Traffic for

What are the nameservers for DNS Record Analysis DNS Lookup


What are the alternatives to

We know of 0 alternatives to

You can suggest alternatives to if you know of any. Alternatives Suggest an alternative

We don't know of any alternatives to this website.

If you know of any, please suggesting one.

Latest Sites
6 minutes ago
20 minutes ago
21 minutes ago
21 minutes ago
21 minutes ago

Latest Reviews review

Must say Gigapros customer service is outstanding, the services included is amazing, and the... review

The group of technical team is experienced and well qualified. They resolve my facebook account... review

Great Site to learn Photography. Really Great Site to learn Photography review legit carding forum review has some great petitions that really get things done!